Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EIF6

Protein Details
Accession S8EIF6   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LCTDSPREPKSRRRNGRRRFNPLEEDHydrophilic
NLS Segment(s)
PositionSequence
23-34EPKSRRRNGRRR
Subcellular Location(s) nucl 16, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MVYHFDLTRALRFCCLCTDSPREPKSRRRNGRRRFNPLEEDVYEPPVLLHSSGPRQVTQVTQVQPRPVSKPSARNNRLSGLPPYTPRPVPLAMPPAYHPGSLTRPAASSPSSRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.28
4 0.31
5 0.38
6 0.41
7 0.5
8 0.54
9 0.57
10 0.59
11 0.67
12 0.72
13 0.75
14 0.78
15 0.8
16 0.86
17 0.88
18 0.93
19 0.93
20 0.91
21 0.89
22 0.84
23 0.79
24 0.72
25 0.66
26 0.56
27 0.51
28 0.41
29 0.35
30 0.28
31 0.22
32 0.18
33 0.14
34 0.12
35 0.08
36 0.08
37 0.08
38 0.1
39 0.14
40 0.15
41 0.14
42 0.15
43 0.15
44 0.15
45 0.16
46 0.19
47 0.18
48 0.22
49 0.23
50 0.25
51 0.26
52 0.28
53 0.28
54 0.25
55 0.29
56 0.29
57 0.37
58 0.44
59 0.53
60 0.55
61 0.57
62 0.58
63 0.54
64 0.52
65 0.46
66 0.41
67 0.34
68 0.33
69 0.3
70 0.32
71 0.34
72 0.32
73 0.3
74 0.3
75 0.26
76 0.26
77 0.28
78 0.3
79 0.27
80 0.28
81 0.29
82 0.31
83 0.31
84 0.29
85 0.25
86 0.22
87 0.26
88 0.29
89 0.29
90 0.24
91 0.23
92 0.25
93 0.27
94 0.25