Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DVS9

Protein Details
Accession S8DVS9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
81-101EQDNHAPPKQKKNKQGPEVEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 10.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSDKDTTSVKAAKPLEGSLGAQKTRTNNPSVATHNAFLKKAQGSGHHAKKGEQRDLSWMEKDSHMLRKRKQLSKGMEEEDEQDNHAPPKQKKNKQGPEVEEDTMEPESEDDDMPSQCHANR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.26
4 0.26
5 0.25
6 0.28
7 0.25
8 0.24
9 0.26
10 0.28
11 0.34
12 0.36
13 0.33
14 0.3
15 0.33
16 0.37
17 0.38
18 0.4
19 0.34
20 0.32
21 0.34
22 0.34
23 0.32
24 0.27
25 0.27
26 0.22
27 0.21
28 0.21
29 0.2
30 0.25
31 0.34
32 0.4
33 0.4
34 0.4
35 0.4
36 0.46
37 0.48
38 0.47
39 0.39
40 0.33
41 0.35
42 0.39
43 0.38
44 0.32
45 0.28
46 0.23
47 0.21
48 0.23
49 0.19
50 0.24
51 0.29
52 0.33
53 0.35
54 0.44
55 0.53
56 0.57
57 0.62
58 0.62
59 0.61
60 0.63
61 0.64
62 0.57
63 0.5
64 0.44
65 0.4
66 0.34
67 0.27
68 0.21
69 0.17
70 0.15
71 0.15
72 0.18
73 0.23
74 0.25
75 0.36
76 0.46
77 0.54
78 0.63
79 0.73
80 0.8
81 0.81
82 0.85
83 0.79
84 0.76
85 0.72
86 0.63
87 0.52
88 0.42
89 0.36
90 0.27
91 0.22
92 0.14
93 0.09
94 0.09
95 0.1
96 0.1
97 0.09
98 0.11
99 0.11
100 0.12
101 0.14