Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8FN24

Protein Details
Accession S8FN24    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRRTKDEHRRRPSRRSRERAPGHSRRHAQVBasic
NLS Segment(s)
PositionSequence
5-26KDEHRRRPSRRSRERAPGHSRR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR006671  Cyclin_N  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences MRRTKDEHRRRPSRRSRERAPGHSRRHAQVAQSGDTEDSLFDYVATAQICKNFLRHTLQPASPDSSQCPAATSSKYGVATVDEFVSTLLRRTRFPEYVVFAALFLLHRLRHSGVPLDADNACVLFLAAYVISAKMYEDTNFSNTYWAVLGRTVKKEDMDRWERELCGLLHWNLLVDPGVLDGFAKAVKRDFCGDGPYPDYRLEEDLSAPEKRFPQLPGNPIDEDEEEPLFAKPAAVPPASVLAALARHKRPVLEKPLPPLPVEHRIVACESSATIRARIKAGPCLDRPPYPPTCWNSAATWLPPVALRVPEHVLSTCNPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.89
5 0.91
6 0.9
7 0.89
8 0.88
9 0.86
10 0.87
11 0.83
12 0.76
13 0.74
14 0.67
15 0.6
16 0.55
17 0.51
18 0.44
19 0.39
20 0.36
21 0.28
22 0.25
23 0.22
24 0.16
25 0.12
26 0.1
27 0.08
28 0.07
29 0.08
30 0.07
31 0.1
32 0.1
33 0.1
34 0.1
35 0.13
36 0.16
37 0.16
38 0.18
39 0.18
40 0.22
41 0.28
42 0.3
43 0.35
44 0.4
45 0.41
46 0.42
47 0.44
48 0.44
49 0.39
50 0.37
51 0.32
52 0.28
53 0.28
54 0.24
55 0.23
56 0.2
57 0.21
58 0.21
59 0.21
60 0.2
61 0.22
62 0.23
63 0.21
64 0.19
65 0.17
66 0.17
67 0.15
68 0.14
69 0.09
70 0.09
71 0.09
72 0.1
73 0.08
74 0.1
75 0.14
76 0.15
77 0.16
78 0.21
79 0.27
80 0.28
81 0.3
82 0.32
83 0.32
84 0.31
85 0.31
86 0.27
87 0.2
88 0.18
89 0.16
90 0.11
91 0.08
92 0.08
93 0.07
94 0.08
95 0.1
96 0.12
97 0.13
98 0.14
99 0.16
100 0.15
101 0.18
102 0.18
103 0.18
104 0.16
105 0.15
106 0.13
107 0.1
108 0.09
109 0.06
110 0.06
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.06
124 0.07
125 0.09
126 0.11
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.1
133 0.09
134 0.07
135 0.08
136 0.12
137 0.14
138 0.17
139 0.18
140 0.18
141 0.19
142 0.21
143 0.23
144 0.28
145 0.3
146 0.3
147 0.33
148 0.33
149 0.32
150 0.3
151 0.29
152 0.2
153 0.16
154 0.16
155 0.13
156 0.12
157 0.11
158 0.11
159 0.08
160 0.09
161 0.07
162 0.04
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.03
170 0.04
171 0.05
172 0.05
173 0.08
174 0.09
175 0.11
176 0.14
177 0.16
178 0.16
179 0.21
180 0.22
181 0.21
182 0.23
183 0.23
184 0.22
185 0.2
186 0.2
187 0.16
188 0.17
189 0.15
190 0.13
191 0.12
192 0.13
193 0.15
194 0.16
195 0.15
196 0.16
197 0.17
198 0.18
199 0.2
200 0.2
201 0.26
202 0.3
203 0.35
204 0.36
205 0.39
206 0.38
207 0.36
208 0.35
209 0.28
210 0.23
211 0.2
212 0.16
213 0.12
214 0.13
215 0.12
216 0.1
217 0.09
218 0.08
219 0.07
220 0.1
221 0.14
222 0.14
223 0.14
224 0.14
225 0.17
226 0.17
227 0.16
228 0.12
229 0.09
230 0.12
231 0.16
232 0.21
233 0.2
234 0.22
235 0.23
236 0.26
237 0.31
238 0.36
239 0.43
240 0.45
241 0.47
242 0.52
243 0.57
244 0.56
245 0.51
246 0.46
247 0.42
248 0.41
249 0.4
250 0.37
251 0.31
252 0.31
253 0.33
254 0.29
255 0.24
256 0.15
257 0.14
258 0.13
259 0.17
260 0.17
261 0.2
262 0.23
263 0.25
264 0.27
265 0.3
266 0.3
267 0.33
268 0.38
269 0.4
270 0.4
271 0.45
272 0.47
273 0.48
274 0.49
275 0.49
276 0.49
277 0.47
278 0.52
279 0.49
280 0.52
281 0.5
282 0.49
283 0.43
284 0.44
285 0.43
286 0.36
287 0.34
288 0.27
289 0.25
290 0.23
291 0.24
292 0.2
293 0.21
294 0.21
295 0.22
296 0.26
297 0.27
298 0.28
299 0.27
300 0.26