Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8F186

Protein Details
Accession S8F186    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-28ADTTRTTHCKCRARRARARVDDAERRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MADTTRTTHCKCRARRARARVDDAERRGASARSWRPGVGVLQRAYVAPATSNGIPISPASARQSTPIGQHAAGPELEEPGGDGGTSPAIPTHVFYPAPRAQDRTTSRPEADAERTACQRIVWQVPSSTQGPPPSRADVPGGARPLRVRGPPAWRVDGKDPTPEVLRRARRPAFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.86
4 0.88
5 0.87
6 0.88
7 0.84
8 0.82
9 0.8
10 0.73
11 0.72
12 0.6
13 0.53
14 0.47
15 0.39
16 0.33
17 0.34
18 0.36
19 0.33
20 0.35
21 0.33
22 0.32
23 0.34
24 0.36
25 0.32
26 0.32
27 0.28
28 0.27
29 0.27
30 0.26
31 0.25
32 0.21
33 0.14
34 0.08
35 0.09
36 0.11
37 0.1
38 0.12
39 0.11
40 0.1
41 0.1
42 0.1
43 0.11
44 0.08
45 0.1
46 0.12
47 0.14
48 0.14
49 0.16
50 0.18
51 0.17
52 0.19
53 0.2
54 0.18
55 0.17
56 0.18
57 0.16
58 0.16
59 0.14
60 0.12
61 0.1
62 0.08
63 0.08
64 0.06
65 0.06
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.04
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.06
79 0.08
80 0.08
81 0.08
82 0.15
83 0.18
84 0.22
85 0.22
86 0.25
87 0.24
88 0.32
89 0.37
90 0.36
91 0.39
92 0.38
93 0.38
94 0.36
95 0.37
96 0.32
97 0.3
98 0.29
99 0.26
100 0.26
101 0.27
102 0.26
103 0.24
104 0.2
105 0.19
106 0.19
107 0.21
108 0.21
109 0.22
110 0.22
111 0.22
112 0.26
113 0.26
114 0.23
115 0.22
116 0.26
117 0.27
118 0.3
119 0.33
120 0.34
121 0.33
122 0.33
123 0.32
124 0.3
125 0.31
126 0.32
127 0.33
128 0.29
129 0.29
130 0.29
131 0.3
132 0.3
133 0.29
134 0.28
135 0.3
136 0.38
137 0.43
138 0.48
139 0.5
140 0.48
141 0.51
142 0.54
143 0.56
144 0.5
145 0.5
146 0.46
147 0.43
148 0.46
149 0.43
150 0.41
151 0.42
152 0.5
153 0.5
154 0.58