Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RU34

Protein Details
Accession F4RU34    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
128-157REILKRQEKLSRKRYKRYKRNIREYQDDTGBasic
NLS Segment(s)
PositionSequence
133-147RQEKLSRKRYKRYKR
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 7.5, mito 3, cysk 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_65130  -  
Amino Acid Sequences MVFPPILGYVTSGILPGFEAIACHDRKPDPNAIPGGGSTSLNVKATSIIYFKTNLEIGYFHKIPDYIAQHVRRHGFLNSHEIEHLIDSMVYLEEKTDDVRKDCCEARVMLVYIRTMLHSEDPEVIVHREILKRQEKLSRKRYKRYKRNIREYQDDTGLLWALIAQEIKRTCDVEDAAAANGRQADGAAPPYTHTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.05
6 0.05
7 0.09
8 0.15
9 0.16
10 0.17
11 0.21
12 0.24
13 0.29
14 0.34
15 0.4
16 0.37
17 0.41
18 0.43
19 0.4
20 0.37
21 0.32
22 0.29
23 0.22
24 0.18
25 0.13
26 0.13
27 0.14
28 0.15
29 0.14
30 0.12
31 0.12
32 0.13
33 0.14
34 0.13
35 0.12
36 0.12
37 0.14
38 0.14
39 0.15
40 0.15
41 0.13
42 0.12
43 0.13
44 0.14
45 0.2
46 0.2
47 0.17
48 0.17
49 0.17
50 0.17
51 0.22
52 0.22
53 0.19
54 0.27
55 0.32
56 0.33
57 0.38
58 0.39
59 0.34
60 0.33
61 0.3
62 0.26
63 0.23
64 0.28
65 0.25
66 0.24
67 0.23
68 0.21
69 0.19
70 0.16
71 0.14
72 0.06
73 0.05
74 0.04
75 0.05
76 0.04
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.05
83 0.08
84 0.09
85 0.11
86 0.13
87 0.14
88 0.17
89 0.18
90 0.18
91 0.16
92 0.16
93 0.16
94 0.17
95 0.16
96 0.14
97 0.14
98 0.12
99 0.11
100 0.11
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.1
113 0.1
114 0.12
115 0.13
116 0.15
117 0.23
118 0.28
119 0.29
120 0.32
121 0.4
122 0.46
123 0.55
124 0.63
125 0.66
126 0.68
127 0.77
128 0.85
129 0.87
130 0.89
131 0.9
132 0.91
133 0.91
134 0.94
135 0.94
136 0.9
137 0.88
138 0.82
139 0.75
140 0.67
141 0.56
142 0.45
143 0.36
144 0.29
145 0.19
146 0.14
147 0.09
148 0.07
149 0.07
150 0.08
151 0.07
152 0.12
153 0.14
154 0.17
155 0.18
156 0.19
157 0.19
158 0.23
159 0.24
160 0.2
161 0.21
162 0.2
163 0.19
164 0.2
165 0.19
166 0.16
167 0.15
168 0.13
169 0.11
170 0.1
171 0.09
172 0.09
173 0.13
174 0.13
175 0.13