Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EUA9

Protein Details
Accession S8EUA9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92DKINCRFWKHNRDKEWIAKRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, mito 4, extr 4
Family & Domain DBs
Amino Acid Sequences CTKCWCWGHTSGQCASFADACPLCGGAHVETEHAKHALCCVSVGLKGGVVPAACPDAHYYCPNCKVNGHGPSDKINCRFWKHNRDKEWIAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.26
4 0.21
5 0.21
6 0.18
7 0.16
8 0.16
9 0.16
10 0.13
11 0.12
12 0.14
13 0.09
14 0.11
15 0.11
16 0.12
17 0.12
18 0.13
19 0.13
20 0.12
21 0.11
22 0.09
23 0.11
24 0.11
25 0.1
26 0.09
27 0.08
28 0.09
29 0.09
30 0.1
31 0.08
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.09
43 0.1
44 0.12
45 0.15
46 0.18
47 0.21
48 0.29
49 0.31
50 0.29
51 0.28
52 0.31
53 0.37
54 0.41
55 0.43
56 0.39
57 0.39
58 0.45
59 0.5
60 0.51
61 0.46
62 0.46
63 0.46
64 0.49
65 0.57
66 0.59
67 0.64
68 0.69
69 0.76
70 0.76
71 0.78
72 0.8