Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8F9A4

Protein Details
Accession S8F9A4   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVPPKPTAPRKRNRKRKRRAASSSSSDDDHydrophilic
NLS Segment(s)
PositionSequence
5-20KPTAPRKRNRKRKRRA
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MVPPKPTAPRKRNRKRKRRAASSSSSDDDSSSDSDVPQVQSVPKLPPVRVASKAPSSQEEETSSSEEESSEAESVRRGVAHQGPQASTIPPRRSPSPDPRPCPIPPFPGDSQDDELLKQRFRKFWMASVADAFSDDLGEIRKEPSLTTPRLALLIDSLAAGADLFAPASGSGEAGINEMDVAMGHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.95
4 0.96
5 0.96
6 0.95
7 0.92
8 0.9
9 0.87
10 0.82
11 0.74
12 0.65
13 0.54
14 0.44
15 0.35
16 0.28
17 0.22
18 0.17
19 0.14
20 0.12
21 0.13
22 0.15
23 0.15
24 0.14
25 0.14
26 0.13
27 0.15
28 0.18
29 0.19
30 0.23
31 0.25
32 0.25
33 0.31
34 0.35
35 0.37
36 0.38
37 0.39
38 0.37
39 0.39
40 0.42
41 0.36
42 0.34
43 0.35
44 0.33
45 0.31
46 0.29
47 0.26
48 0.25
49 0.25
50 0.22
51 0.17
52 0.16
53 0.14
54 0.11
55 0.09
56 0.09
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.07
64 0.06
65 0.1
66 0.14
67 0.18
68 0.2
69 0.21
70 0.21
71 0.22
72 0.23
73 0.19
74 0.19
75 0.22
76 0.23
77 0.25
78 0.27
79 0.29
80 0.33
81 0.39
82 0.46
83 0.51
84 0.56
85 0.57
86 0.57
87 0.59
88 0.54
89 0.54
90 0.46
91 0.4
92 0.34
93 0.36
94 0.34
95 0.33
96 0.34
97 0.31
98 0.31
99 0.27
100 0.25
101 0.2
102 0.24
103 0.21
104 0.21
105 0.25
106 0.26
107 0.27
108 0.31
109 0.38
110 0.35
111 0.38
112 0.44
113 0.4
114 0.38
115 0.37
116 0.33
117 0.25
118 0.23
119 0.18
120 0.09
121 0.07
122 0.06
123 0.05
124 0.06
125 0.07
126 0.07
127 0.08
128 0.1
129 0.1
130 0.11
131 0.18
132 0.24
133 0.26
134 0.27
135 0.27
136 0.26
137 0.27
138 0.26
139 0.19
140 0.13
141 0.11
142 0.09
143 0.08
144 0.07
145 0.06
146 0.06
147 0.05
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.06
156 0.06
157 0.06
158 0.06
159 0.07
160 0.08
161 0.08
162 0.08
163 0.06
164 0.06
165 0.06
166 0.05