Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8EXP4

Protein Details
Accession S8EXP4    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
175-196ESAPSRRPIKPLPKRKPQITVLHydrophilic
NLS Segment(s)
PositionSequence
180-190RRPIKPLPKRK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR027921  NOPCHAP1  
Gene Ontology GO:0000492  P:box C/D snoRNP assembly  
Pfam View protein in Pfam  
PF15370  NOPCHAP1  
Amino Acid Sequences MPTDEDKGKTRDVEILEVEDEEQRRARMHDVFARLDASSRPHVLPRPVLPNLNGQSSTPLEPNSELLSRVQAFLPQLADSNAELARRVQGDPSAVDIENVDAGGAYIEMGSNLGLGVFEQRHNASSRSSSDAETGSDADADSDSSTDDSDTSTSSSDSDDDGTSSDSDSSSSDPESAPSRRPIKPLPKRKPQITVLGEDSRERGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.25
4 0.24
5 0.23
6 0.21
7 0.2
8 0.18
9 0.18
10 0.17
11 0.18
12 0.2
13 0.23
14 0.24
15 0.29
16 0.33
17 0.37
18 0.37
19 0.37
20 0.36
21 0.31
22 0.28
23 0.24
24 0.21
25 0.2
26 0.21
27 0.21
28 0.24
29 0.28
30 0.31
31 0.35
32 0.35
33 0.38
34 0.38
35 0.4
36 0.37
37 0.41
38 0.39
39 0.37
40 0.32
41 0.25
42 0.26
43 0.26
44 0.26
45 0.19
46 0.18
47 0.16
48 0.16
49 0.17
50 0.16
51 0.15
52 0.13
53 0.13
54 0.16
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.13
61 0.13
62 0.1
63 0.1
64 0.09
65 0.1
66 0.09
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.11
75 0.09
76 0.1
77 0.11
78 0.11
79 0.13
80 0.13
81 0.11
82 0.11
83 0.1
84 0.09
85 0.08
86 0.08
87 0.05
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.04
104 0.05
105 0.06
106 0.07
107 0.08
108 0.1
109 0.12
110 0.13
111 0.13
112 0.15
113 0.17
114 0.2
115 0.21
116 0.2
117 0.2
118 0.2
119 0.19
120 0.17
121 0.15
122 0.1
123 0.09
124 0.08
125 0.07
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.09
143 0.08
144 0.09
145 0.1
146 0.09
147 0.09
148 0.1
149 0.11
150 0.1
151 0.1
152 0.1
153 0.08
154 0.09
155 0.09
156 0.1
157 0.1
158 0.11
159 0.11
160 0.11
161 0.13
162 0.18
163 0.2
164 0.23
165 0.3
166 0.36
167 0.38
168 0.44
169 0.52
170 0.57
171 0.66
172 0.73
173 0.75
174 0.79
175 0.85
176 0.86
177 0.85
178 0.8
179 0.79
180 0.73
181 0.68
182 0.64
183 0.6
184 0.54
185 0.47