Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DMI0

Protein Details
Accession S8DMI0    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-38TPKPSNTKGETNKRVPRQNQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001969  Aspartic_peptidase_AS  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
Amino Acid Sequences MEDSDPEDQPSPTKKSNSTPKPSNTKGETNKRVPRQNQVQAQVDQWQLLGKVLSTPVTLQVGEVFGMSKEMSHHLQEILKPVKSPAASSKHVVATAFLPRTKGILIHLRMEIDDKPIMAIIDTGSQLNIASRRIWKTLIHRPMDVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.59
4 0.64
5 0.67
6 0.69
7 0.72
8 0.77
9 0.77
10 0.76
11 0.71
12 0.7
13 0.71
14 0.73
15 0.73
16 0.73
17 0.77
18 0.76
19 0.8
20 0.74
21 0.74
22 0.73
23 0.73
24 0.71
25 0.68
26 0.65
27 0.57
28 0.55
29 0.5
30 0.4
31 0.31
32 0.24
33 0.18
34 0.13
35 0.12
36 0.11
37 0.06
38 0.06
39 0.07
40 0.08
41 0.07
42 0.07
43 0.08
44 0.09
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.07
58 0.09
59 0.09
60 0.1
61 0.1
62 0.12
63 0.12
64 0.18
65 0.19
66 0.18
67 0.18
68 0.17
69 0.2
70 0.18
71 0.19
72 0.2
73 0.23
74 0.25
75 0.26
76 0.29
77 0.27
78 0.27
79 0.26
80 0.2
81 0.15
82 0.19
83 0.2
84 0.17
85 0.17
86 0.17
87 0.18
88 0.17
89 0.16
90 0.14
91 0.2
92 0.22
93 0.24
94 0.24
95 0.24
96 0.24
97 0.25
98 0.22
99 0.17
100 0.16
101 0.12
102 0.12
103 0.12
104 0.12
105 0.1
106 0.09
107 0.07
108 0.08
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.11
115 0.12
116 0.12
117 0.14
118 0.2
119 0.24
120 0.27
121 0.29
122 0.32
123 0.39
124 0.48
125 0.54
126 0.52