Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RY60

Protein Details
Accession F4RY60    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-37LYLTIKIGNKKRKRIRTADLTAHydrophilic
NLS Segment(s)
PositionSequence
25-29KKRKR
Subcellular Location(s) mito 13, nucl 5, extr 5, cyto 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_109953  -  
Amino Acid Sequences MVGVSKHALIPPAGLLYLTIKIGNKKRKRIRTADLTATPAVPLARGANTHLRCFANPSIAGFNCLDALARKGIRPESRDGVSAEKRSVHCAKCSPNEKQGPGQRRAITTRETNVEKVKWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.11
6 0.11
7 0.12
8 0.2
9 0.29
10 0.39
11 0.45
12 0.55
13 0.64
14 0.73
15 0.8
16 0.81
17 0.81
18 0.81
19 0.79
20 0.77
21 0.69
22 0.62
23 0.54
24 0.45
25 0.36
26 0.27
27 0.2
28 0.12
29 0.09
30 0.07
31 0.07
32 0.07
33 0.1
34 0.18
35 0.2
36 0.2
37 0.23
38 0.23
39 0.22
40 0.27
41 0.25
42 0.2
43 0.18
44 0.19
45 0.19
46 0.18
47 0.2
48 0.15
49 0.14
50 0.11
51 0.11
52 0.09
53 0.06
54 0.08
55 0.09
56 0.09
57 0.1
58 0.12
59 0.17
60 0.21
61 0.23
62 0.27
63 0.29
64 0.29
65 0.31
66 0.3
67 0.31
68 0.32
69 0.32
70 0.28
71 0.29
72 0.28
73 0.33
74 0.38
75 0.34
76 0.34
77 0.37
78 0.43
79 0.48
80 0.54
81 0.53
82 0.56
83 0.6
84 0.59
85 0.63
86 0.65
87 0.64
88 0.62
89 0.64
90 0.58
91 0.56
92 0.57
93 0.52
94 0.48
95 0.45
96 0.46
97 0.45
98 0.45
99 0.45
100 0.47