Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8ET99

Protein Details
Accession S8ET99    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-81ADAKALKKLEKKHKNALKKKEABasic
NLS Segment(s)
PositionSequence
63-81KALKKLEKKHKNALKKKEA
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSPTNSTTTCRLRSNSKAELVQQAPASEGLVKDRSANKKRKHQDSDSKPAEDKQEDFNDADAKALKKLEKKHKNALKKKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.53
4 0.5
5 0.47
6 0.51
7 0.45
8 0.4
9 0.33
10 0.27
11 0.23
12 0.2
13 0.18
14 0.12
15 0.11
16 0.1
17 0.11
18 0.11
19 0.13
20 0.2
21 0.29
22 0.36
23 0.46
24 0.5
25 0.59
26 0.67
27 0.73
28 0.74
29 0.74
30 0.76
31 0.75
32 0.79
33 0.73
34 0.67
35 0.58
36 0.53
37 0.49
38 0.4
39 0.33
40 0.29
41 0.28
42 0.28
43 0.27
44 0.27
45 0.24
46 0.22
47 0.21
48 0.18
49 0.16
50 0.16
51 0.18
52 0.21
53 0.26
54 0.35
55 0.45
56 0.53
57 0.59
58 0.68
59 0.75
60 0.82
61 0.86