Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DYX8

Protein Details
Accession S8DYX8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
284-306KMDIRKEAIKRQKKMSSKQKQRDBasic
NLS Segment(s)
PositionSequence
290-303EAIKRQKKMSSKQK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.333, cyto 6, cyto_pero 4.833, pero 2.5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004808  AP_endonuc_1  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MRDKKIGVLVVQEAHMNEERRCKVENLFAQRLRIIATGDPENPTGKSGVAIVLNKEIVNMQNVVATTVYEGRALQVQLRLKHETTLTILGVYAPNDPDLNEFLWEDIRDFYQKPENRDIPKPDIMLGDFNLVEEPLDRMPPHKDHQGAVNTLGDLKTLLHLQDGWRQLNPTDKSFTFYQKATGSQSRIDRVYMTENMCLRSREWEIRPSGIPNTDHMMVSVSVTSEDAPWVGAGRRTVPVYVLKDKRMKEYIRTRIDKAIDHLTDLGGWRSNDENPQRILHDLKMDIRKEAIKRQKKMSSKQKQRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.25
4 0.24
5 0.32
6 0.34
7 0.35
8 0.38
9 0.36
10 0.36
11 0.43
12 0.49
13 0.49
14 0.55
15 0.55
16 0.54
17 0.53
18 0.48
19 0.41
20 0.34
21 0.26
22 0.18
23 0.2
24 0.21
25 0.22
26 0.24
27 0.23
28 0.24
29 0.22
30 0.21
31 0.18
32 0.14
33 0.13
34 0.11
35 0.12
36 0.15
37 0.16
38 0.16
39 0.18
40 0.19
41 0.18
42 0.17
43 0.16
44 0.13
45 0.14
46 0.13
47 0.11
48 0.12
49 0.12
50 0.13
51 0.11
52 0.1
53 0.09
54 0.11
55 0.11
56 0.09
57 0.09
58 0.09
59 0.12
60 0.13
61 0.13
62 0.17
63 0.22
64 0.25
65 0.3
66 0.33
67 0.31
68 0.32
69 0.31
70 0.27
71 0.25
72 0.23
73 0.19
74 0.15
75 0.14
76 0.13
77 0.13
78 0.12
79 0.1
80 0.08
81 0.09
82 0.09
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.1
89 0.09
90 0.11
91 0.11
92 0.1
93 0.09
94 0.1
95 0.11
96 0.11
97 0.13
98 0.21
99 0.24
100 0.29
101 0.36
102 0.41
103 0.44
104 0.5
105 0.53
106 0.49
107 0.49
108 0.45
109 0.37
110 0.32
111 0.28
112 0.23
113 0.18
114 0.14
115 0.11
116 0.1
117 0.09
118 0.07
119 0.07
120 0.06
121 0.06
122 0.05
123 0.06
124 0.06
125 0.08
126 0.12
127 0.15
128 0.18
129 0.22
130 0.23
131 0.22
132 0.28
133 0.3
134 0.27
135 0.25
136 0.22
137 0.17
138 0.16
139 0.16
140 0.1
141 0.07
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.07
149 0.13
150 0.17
151 0.17
152 0.17
153 0.18
154 0.18
155 0.26
156 0.27
157 0.23
158 0.24
159 0.23
160 0.26
161 0.27
162 0.31
163 0.25
164 0.23
165 0.25
166 0.22
167 0.24
168 0.25
169 0.27
170 0.25
171 0.26
172 0.29
173 0.28
174 0.27
175 0.26
176 0.22
177 0.2
178 0.22
179 0.22
180 0.21
181 0.22
182 0.22
183 0.24
184 0.25
185 0.24
186 0.2
187 0.21
188 0.24
189 0.26
190 0.28
191 0.32
192 0.32
193 0.34
194 0.35
195 0.33
196 0.32
197 0.29
198 0.27
199 0.23
200 0.25
201 0.23
202 0.21
203 0.19
204 0.18
205 0.14
206 0.14
207 0.12
208 0.08
209 0.07
210 0.07
211 0.08
212 0.06
213 0.06
214 0.06
215 0.05
216 0.05
217 0.06
218 0.08
219 0.09
220 0.1
221 0.12
222 0.15
223 0.16
224 0.16
225 0.17
226 0.22
227 0.26
228 0.35
229 0.37
230 0.41
231 0.47
232 0.48
233 0.53
234 0.54
235 0.51
236 0.52
237 0.58
238 0.61
239 0.65
240 0.68
241 0.64
242 0.63
243 0.64
244 0.56
245 0.5
246 0.49
247 0.39
248 0.36
249 0.34
250 0.27
251 0.25
252 0.23
253 0.21
254 0.16
255 0.15
256 0.16
257 0.17
258 0.2
259 0.27
260 0.32
261 0.35
262 0.34
263 0.37
264 0.36
265 0.38
266 0.39
267 0.33
268 0.33
269 0.31
270 0.36
271 0.42
272 0.41
273 0.39
274 0.39
275 0.43
276 0.42
277 0.49
278 0.52
279 0.54
280 0.6
281 0.68
282 0.74
283 0.77
284 0.83
285 0.84
286 0.84