Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DNY2

Protein Details
Accession S8DNY2   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
175-196ESAPSRRPIKPLPKRKPQITVLHydrophilic
NLS Segment(s)
PositionSequence
180-190RRPIKPLPKRK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR027921  NOPCHAP1  
Gene Ontology GO:0000492  P:box C/D snoRNP assembly  
Pfam View protein in Pfam  
PF15370  NOPCHAP1  
Amino Acid Sequences MPTDEDKGKTRAVEILEVEDEEQRRARMHDVFARLDASSRPHVLPRPVLPNLNGQSSTPLEPNSELLSRVQAFLPQLADSNAELARRVQGDPSAVDIENVDAGGAYIEMGSNLGLGVFEQRHNAGSRSSSDAETDSDADADSDSSTDDSDTSTSSSDSDGDGTSSDSDSSSSDPESAPSRRPIKPLPKRKPQITVLGEDSRERGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.24
5 0.23
6 0.23
7 0.21
8 0.19
9 0.2
10 0.17
11 0.18
12 0.2
13 0.23
14 0.24
15 0.29
16 0.33
17 0.37
18 0.37
19 0.37
20 0.36
21 0.31
22 0.28
23 0.24
24 0.21
25 0.2
26 0.21
27 0.21
28 0.24
29 0.28
30 0.31
31 0.35
32 0.35
33 0.38
34 0.38
35 0.4
36 0.37
37 0.41
38 0.39
39 0.37
40 0.32
41 0.25
42 0.26
43 0.26
44 0.26
45 0.19
46 0.18
47 0.16
48 0.16
49 0.17
50 0.16
51 0.15
52 0.13
53 0.13
54 0.16
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.13
61 0.13
62 0.1
63 0.1
64 0.09
65 0.1
66 0.09
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.11
75 0.09
76 0.1
77 0.11
78 0.11
79 0.13
80 0.13
81 0.11
82 0.11
83 0.1
84 0.09
85 0.08
86 0.08
87 0.05
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.04
104 0.05
105 0.06
106 0.07
107 0.07
108 0.09
109 0.11
110 0.11
111 0.11
112 0.12
113 0.13
114 0.18
115 0.19
116 0.18
117 0.17
118 0.17
119 0.17
120 0.17
121 0.16
122 0.11
123 0.09
124 0.09
125 0.08
126 0.07
127 0.07
128 0.05
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.09
146 0.08
147 0.08
148 0.08
149 0.09
150 0.09
151 0.09
152 0.09
153 0.08
154 0.08
155 0.09
156 0.1
157 0.11
158 0.11
159 0.11
160 0.11
161 0.13
162 0.18
163 0.2
164 0.23
165 0.3
166 0.36
167 0.38
168 0.44
169 0.52
170 0.57
171 0.66
172 0.73
173 0.75
174 0.79
175 0.85
176 0.86
177 0.85
178 0.8
179 0.79
180 0.73
181 0.68
182 0.64
183 0.6
184 0.54
185 0.47