Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8DYV7

Protein Details
Accession S8DYV7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-103IACCRHVFPWSNRRRRRPAFSVCRLRRIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, pero 6, cyto_mito 6, nucl 4
Family & Domain DBs
Amino Acid Sequences MVHAPAVVLAHVDLLDGLGRLGRPHRATGAAPRLPGVLVDPRVLGWRPGRMAQQSRRRHGRRDVLETQCFQYPGIACCRHVFPWSNRRRRRPAFSVCRLRRIFFLWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.09
9 0.16
10 0.17
11 0.19
12 0.21
13 0.23
14 0.24
15 0.31
16 0.38
17 0.34
18 0.32
19 0.31
20 0.29
21 0.26
22 0.25
23 0.18
24 0.14
25 0.13
26 0.13
27 0.13
28 0.13
29 0.15
30 0.15
31 0.16
32 0.13
33 0.14
34 0.15
35 0.17
36 0.2
37 0.23
38 0.29
39 0.35
40 0.44
41 0.48
42 0.54
43 0.62
44 0.62
45 0.64
46 0.65
47 0.66
48 0.62
49 0.63
50 0.64
51 0.61
52 0.61
53 0.57
54 0.5
55 0.42
56 0.37
57 0.28
58 0.23
59 0.18
60 0.16
61 0.22
62 0.22
63 0.21
64 0.23
65 0.25
66 0.24
67 0.26
68 0.31
69 0.32
70 0.41
71 0.51
72 0.6
73 0.66
74 0.75
75 0.82
76 0.84
77 0.85
78 0.84
79 0.84
80 0.84
81 0.85
82 0.87
83 0.82
84 0.83
85 0.77
86 0.69
87 0.61