Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8EIM3

Protein Details
Accession S8EIM3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-78VTRGAGFRKEKNKKKRGSYRGGDITBasic
NLS Segment(s)
PositionSequence
59-70GFRKEKNKKKRG
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences GNGKGKTRKVNTPFQRVQAGGVRFIDDRLKDNTFESRGAGMGDYGERAARDLIVTRGAGFRKEKNKKKRGSYRGGDITMQSFSVKFTDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.56
4 0.53
5 0.5
6 0.42
7 0.34
8 0.3
9 0.28
10 0.23
11 0.24
12 0.24
13 0.18
14 0.19
15 0.21
16 0.22
17 0.2
18 0.22
19 0.25
20 0.23
21 0.22
22 0.2
23 0.16
24 0.15
25 0.14
26 0.13
27 0.08
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.08
41 0.08
42 0.08
43 0.12
44 0.12
45 0.15
46 0.17
47 0.23
48 0.32
49 0.43
50 0.52
51 0.6
52 0.69
53 0.75
54 0.83
55 0.87
56 0.86
57 0.86
58 0.83
59 0.81
60 0.8
61 0.74
62 0.64
63 0.54
64 0.47
65 0.37
66 0.31
67 0.22
68 0.14
69 0.13
70 0.13