Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8F8R6

Protein Details
Accession S8F8R6   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MSTTRISNRPKIPTEKRRAAESPPPSSKPSKKARPGSPAPASHydrophilic
NLS Segment(s)
PositionSequence
9-38RPKIPTEKRRAAESPPPSSKPSKKARPGSP
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSTTRISNRPKIPTEKRRAAESPPPSSKPSKKARPGSPAPASSTQASGASAKAPAVSSKDPAARAKAPATSMKAPATSGKVPATSGKGPATSGKVPAMSGKALATSGKPPATSGKPPVTSGKPPVTSGKPLAASGKPVGASSKAPAMSRNLKGPVASATSPVSGSARTLQRGSVEIEEVEDIDETRSRQRASETITVGSSSSSEDDDGKVDTGLSGGEDLAEETAEQELGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.77
4 0.76
5 0.72
6 0.69
7 0.68
8 0.65
9 0.64
10 0.62
11 0.62
12 0.59
13 0.65
14 0.65
15 0.65
16 0.67
17 0.68
18 0.71
19 0.77
20 0.8
21 0.81
22 0.81
23 0.81
24 0.78
25 0.7
26 0.66
27 0.6
28 0.55
29 0.46
30 0.39
31 0.31
32 0.24
33 0.22
34 0.17
35 0.13
36 0.11
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.14
43 0.15
44 0.16
45 0.2
46 0.23
47 0.25
48 0.27
49 0.31
50 0.28
51 0.29
52 0.29
53 0.27
54 0.27
55 0.28
56 0.31
57 0.28
58 0.29
59 0.27
60 0.26
61 0.24
62 0.24
63 0.25
64 0.2
65 0.2
66 0.19
67 0.18
68 0.18
69 0.19
70 0.22
71 0.18
72 0.19
73 0.18
74 0.17
75 0.17
76 0.18
77 0.21
78 0.17
79 0.18
80 0.16
81 0.15
82 0.15
83 0.16
84 0.15
85 0.11
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.1
94 0.11
95 0.1
96 0.11
97 0.15
98 0.18
99 0.2
100 0.23
101 0.25
102 0.25
103 0.27
104 0.3
105 0.3
106 0.29
107 0.31
108 0.31
109 0.27
110 0.28
111 0.31
112 0.29
113 0.28
114 0.27
115 0.25
116 0.21
117 0.21
118 0.22
119 0.18
120 0.18
121 0.16
122 0.16
123 0.13
124 0.12
125 0.13
126 0.11
127 0.12
128 0.1
129 0.14
130 0.14
131 0.14
132 0.15
133 0.2
134 0.25
135 0.27
136 0.3
137 0.28
138 0.27
139 0.27
140 0.27
141 0.23
142 0.2
143 0.19
144 0.16
145 0.15
146 0.15
147 0.15
148 0.14
149 0.13
150 0.09
151 0.1
152 0.14
153 0.16
154 0.18
155 0.18
156 0.19
157 0.19
158 0.21
159 0.22
160 0.18
161 0.16
162 0.14
163 0.14
164 0.13
165 0.12
166 0.11
167 0.08
168 0.07
169 0.07
170 0.09
171 0.09
172 0.14
173 0.18
174 0.18
175 0.19
176 0.23
177 0.26
178 0.31
179 0.37
180 0.35
181 0.32
182 0.32
183 0.31
184 0.28
185 0.23
186 0.17
187 0.11
188 0.1
189 0.09
190 0.1
191 0.1
192 0.11
193 0.12
194 0.13
195 0.12
196 0.11
197 0.1
198 0.09
199 0.08
200 0.08
201 0.07
202 0.06
203 0.05
204 0.05
205 0.05
206 0.06
207 0.06
208 0.06
209 0.05
210 0.05
211 0.06