Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8F1K9

Protein Details
Accession S8F1K9    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
95-123RLTPFEQKQKTLKQRKKDIHFPLRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
77-114KKYKPLDLRAKKTRAIRRRLTPFEQKQKTLKQRKKDIH
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLAELKNELLTLRVQKIAGGSAAKLTKINTVRKSIARVMTVMNQKQRQNLRELYKTKKYKPLDLRAKKTRAIRRRLTPFEQKQKTLKQRKKDIHFPLRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.1
28 0.12
29 0.13
30 0.13
31 0.13
32 0.13
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.3
44 0.27
45 0.24
46 0.26
47 0.3
48 0.29
49 0.3
50 0.31
51 0.32
52 0.37
53 0.41
54 0.37
55 0.37
56 0.41
57 0.41
58 0.45
59 0.48
60 0.49
61 0.54
62 0.58
63 0.58
64 0.6
65 0.58
66 0.59
67 0.64
68 0.67
69 0.69
70 0.72
71 0.77
72 0.77
73 0.78
74 0.73
75 0.73
76 0.72
77 0.7
78 0.7
79 0.69
80 0.7
81 0.76
82 0.78
83 0.76
84 0.77
85 0.78
86 0.8
87 0.78
88 0.73
89 0.71
90 0.74
91 0.78
92 0.78
93 0.76
94 0.75
95 0.8
96 0.85
97 0.86
98 0.86
99 0.86
100 0.86
101 0.87
102 0.82
103 0.82
104 0.81
105 0.76