Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RXA1

Protein Details
Accession F4RXA1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
144-168MARDRFMSRIKKHRNKKQVIKPTYAHydrophilic
NLS Segment(s)
PositionSequence
154-159KKHRNK
Subcellular Location(s) mito 16.5, mito_nucl 12.5, nucl 7.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_65935  -  
Amino Acid Sequences MIPKALSRCLTRLELLATFVCLLRLTQDAHGRGIPKNQRGIWNTVAEKQVGTSSEFVKRSLLKECYRGITPVEESRTEENALLVSDIKPLAHKPNIEISKNTLNTENVKGVNENGRFNRKLLSWLACGADSCKYNLEDFDKPFMARDRFMSRIKKHRNKKQVIKPTYAHQLGAVEKDFSVNSNVDKEYFQRHDRIFSSKGTSPSSRSTTSEEENDDETFSFHPDGGRSLRLEEQRSPSPFLTHVGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.2
5 0.18
6 0.16
7 0.15
8 0.11
9 0.1
10 0.1
11 0.12
12 0.13
13 0.17
14 0.24
15 0.25
16 0.27
17 0.3
18 0.3
19 0.31
20 0.38
21 0.41
22 0.39
23 0.45
24 0.46
25 0.52
26 0.53
27 0.57
28 0.52
29 0.51
30 0.47
31 0.45
32 0.43
33 0.35
34 0.31
35 0.26
36 0.24
37 0.18
38 0.17
39 0.15
40 0.16
41 0.22
42 0.23
43 0.23
44 0.24
45 0.26
46 0.26
47 0.32
48 0.36
49 0.32
50 0.36
51 0.38
52 0.38
53 0.37
54 0.36
55 0.3
56 0.26
57 0.26
58 0.26
59 0.26
60 0.24
61 0.25
62 0.27
63 0.27
64 0.25
65 0.22
66 0.17
67 0.15
68 0.14
69 0.11
70 0.09
71 0.07
72 0.08
73 0.08
74 0.07
75 0.08
76 0.1
77 0.15
78 0.17
79 0.17
80 0.18
81 0.27
82 0.32
83 0.33
84 0.32
85 0.31
86 0.36
87 0.37
88 0.36
89 0.29
90 0.25
91 0.26
92 0.28
93 0.26
94 0.18
95 0.18
96 0.17
97 0.16
98 0.22
99 0.21
100 0.22
101 0.22
102 0.27
103 0.27
104 0.27
105 0.28
106 0.22
107 0.23
108 0.22
109 0.22
110 0.18
111 0.18
112 0.18
113 0.16
114 0.16
115 0.13
116 0.13
117 0.11
118 0.11
119 0.11
120 0.11
121 0.11
122 0.13
123 0.16
124 0.17
125 0.18
126 0.21
127 0.2
128 0.19
129 0.21
130 0.25
131 0.22
132 0.19
133 0.21
134 0.23
135 0.27
136 0.33
137 0.4
138 0.41
139 0.5
140 0.6
141 0.66
142 0.71
143 0.77
144 0.82
145 0.83
146 0.88
147 0.88
148 0.88
149 0.84
150 0.8
151 0.72
152 0.66
153 0.65
154 0.55
155 0.44
156 0.34
157 0.31
158 0.26
159 0.26
160 0.22
161 0.14
162 0.12
163 0.13
164 0.13
165 0.11
166 0.12
167 0.11
168 0.11
169 0.14
170 0.14
171 0.15
172 0.15
173 0.16
174 0.22
175 0.26
176 0.28
177 0.32
178 0.32
179 0.37
180 0.38
181 0.42
182 0.37
183 0.35
184 0.38
185 0.36
186 0.39
187 0.39
188 0.39
189 0.37
190 0.41
191 0.43
192 0.39
193 0.37
194 0.39
195 0.38
196 0.4
197 0.4
198 0.37
199 0.34
200 0.34
201 0.32
202 0.27
203 0.22
204 0.19
205 0.16
206 0.15
207 0.13
208 0.12
209 0.13
210 0.13
211 0.17
212 0.19
213 0.22
214 0.2
215 0.23
216 0.29
217 0.34
218 0.38
219 0.4
220 0.43
221 0.48
222 0.51
223 0.53
224 0.47
225 0.44
226 0.41
227 0.38