Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8G6I3

Protein Details
Accession S8G6I3   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
188-211QGLEPSRKGGRKRAPRPKRGRRPABasic
NLS Segment(s)
PositionSequence
91-98KPPVRIRR
193-211SRKGGRKRAPRPKRGRRPA
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAPLSHSLRICRRALSLTDAFPEPAPRLDNHDRRRDDAPRRQDERSAWERPTKEPIRDESPGSAPKIHPDRARLLQTTPGLPQPQDEPNKKPPVRIRRPPPMAKLPDIPSLPEKPPPEVAFGRVDDHTRPDSLRRTGSSLLDRLSLDDSVPHRPEASPSLRDRMDAFGNGPGEGSYGDMVDTNVEMGQGLEPSRKGGRKRAPRPKRGRRPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.37
4 0.33
5 0.34
6 0.33
7 0.31
8 0.27
9 0.27
10 0.21
11 0.2
12 0.2
13 0.18
14 0.26
15 0.35
16 0.44
17 0.5
18 0.58
19 0.58
20 0.6
21 0.66
22 0.67
23 0.67
24 0.67
25 0.69
26 0.69
27 0.71
28 0.7
29 0.68
30 0.62
31 0.6
32 0.57
33 0.51
34 0.45
35 0.47
36 0.46
37 0.44
38 0.51
39 0.48
40 0.46
41 0.45
42 0.47
43 0.47
44 0.47
45 0.46
46 0.39
47 0.39
48 0.37
49 0.34
50 0.32
51 0.25
52 0.3
53 0.34
54 0.35
55 0.33
56 0.33
57 0.38
58 0.41
59 0.45
60 0.39
61 0.34
62 0.35
63 0.34
64 0.31
65 0.27
66 0.24
67 0.21
68 0.2
69 0.19
70 0.17
71 0.23
72 0.29
73 0.31
74 0.34
75 0.41
76 0.51
77 0.51
78 0.53
79 0.55
80 0.58
81 0.64
82 0.68
83 0.68
84 0.68
85 0.75
86 0.75
87 0.72
88 0.69
89 0.63
90 0.56
91 0.52
92 0.45
93 0.41
94 0.37
95 0.32
96 0.26
97 0.27
98 0.25
99 0.26
100 0.24
101 0.21
102 0.25
103 0.24
104 0.26
105 0.23
106 0.24
107 0.22
108 0.22
109 0.22
110 0.19
111 0.2
112 0.15
113 0.18
114 0.17
115 0.15
116 0.15
117 0.18
118 0.23
119 0.25
120 0.27
121 0.25
122 0.28
123 0.29
124 0.32
125 0.31
126 0.28
127 0.25
128 0.24
129 0.22
130 0.19
131 0.19
132 0.15
133 0.12
134 0.14
135 0.15
136 0.19
137 0.21
138 0.2
139 0.19
140 0.19
141 0.22
142 0.25
143 0.28
144 0.28
145 0.29
146 0.35
147 0.34
148 0.35
149 0.34
150 0.31
151 0.28
152 0.23
153 0.22
154 0.2
155 0.2
156 0.19
157 0.18
158 0.14
159 0.12
160 0.11
161 0.1
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.06
174 0.06
175 0.07
176 0.08
177 0.1
178 0.11
179 0.15
180 0.22
181 0.27
182 0.31
183 0.4
184 0.5
185 0.58
186 0.69
187 0.77
188 0.81
189 0.86
190 0.93
191 0.94