Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8E090

Protein Details
Accession S8E090    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-93KINCRFWKHNRDKEWIAKRRBasic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 9, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences CTKCWRWGHTSGQCASFADACPLCGGAHVETEHAKHALCCVSVGLKGGVVPAVCPDAHYYCPNCKVNGHGPSDKINCRFWKHNRDKEWIAKRRSEAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.31
4 0.24
5 0.22
6 0.19
7 0.17
8 0.16
9 0.16
10 0.14
11 0.13
12 0.14
13 0.09
14 0.11
15 0.11
16 0.12
17 0.12
18 0.13
19 0.14
20 0.12
21 0.12
22 0.09
23 0.11
24 0.11
25 0.1
26 0.1
27 0.08
28 0.09
29 0.09
30 0.1
31 0.08
32 0.07
33 0.07
34 0.06
35 0.07
36 0.05
37 0.05
38 0.04
39 0.06
40 0.05
41 0.06
42 0.08
43 0.09
44 0.12
45 0.14
46 0.16
47 0.2
48 0.27
49 0.29
50 0.28
51 0.26
52 0.29
53 0.35
54 0.39
55 0.41
56 0.37
57 0.37
58 0.43
59 0.48
60 0.49
61 0.44
62 0.43
63 0.43
64 0.46
65 0.54
66 0.56
67 0.62
68 0.67
69 0.74
70 0.74
71 0.77
72 0.78
73 0.79
74 0.81
75 0.79
76 0.75
77 0.72
78 0.7