Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8DPR4

Protein Details
Accession S8DPR4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-78EKPAPLSKTPQRRMRRPPSRKPTPRLFINHydrophilic
NLS Segment(s)
PositionSequence
57-73KTPQRRMRRPPSRKPTP
Subcellular Location(s) mito 16, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSPGHGLAPGAIAAIVIGTLFVLVGLSAAGIILHYRRRPVTCDSPSSMEKPAPLSKTPQRRMRRPPSRKPTPRLFINEISFPMPLARKGRDRKRDYENSPVSTLDMVISPSLPRIFKLSAEGGESAAVEVRVTPPTPIASRAELGVPSPTKLKPNVKARFQTSSGVGLGMLPMGNESTRLVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.04
20 0.06
21 0.12
22 0.13
23 0.17
24 0.21
25 0.23
26 0.27
27 0.34
28 0.42
29 0.43
30 0.47
31 0.47
32 0.48
33 0.48
34 0.47
35 0.42
36 0.32
37 0.28
38 0.27
39 0.29
40 0.27
41 0.26
42 0.3
43 0.36
44 0.45
45 0.53
46 0.58
47 0.61
48 0.67
49 0.76
50 0.81
51 0.84
52 0.83
53 0.86
54 0.87
55 0.9
56 0.9
57 0.86
58 0.84
59 0.8
60 0.76
61 0.72
62 0.67
63 0.61
64 0.54
65 0.48
66 0.4
67 0.34
68 0.27
69 0.2
70 0.16
71 0.12
72 0.12
73 0.14
74 0.16
75 0.23
76 0.31
77 0.41
78 0.49
79 0.54
80 0.57
81 0.63
82 0.69
83 0.65
84 0.67
85 0.62
86 0.55
87 0.51
88 0.45
89 0.37
90 0.28
91 0.24
92 0.14
93 0.09
94 0.07
95 0.05
96 0.06
97 0.05
98 0.07
99 0.08
100 0.08
101 0.08
102 0.11
103 0.12
104 0.12
105 0.16
106 0.16
107 0.15
108 0.17
109 0.17
110 0.14
111 0.13
112 0.13
113 0.09
114 0.08
115 0.07
116 0.05
117 0.05
118 0.06
119 0.07
120 0.08
121 0.08
122 0.09
123 0.12
124 0.13
125 0.16
126 0.17
127 0.18
128 0.18
129 0.18
130 0.18
131 0.16
132 0.16
133 0.19
134 0.17
135 0.16
136 0.19
137 0.19
138 0.22
139 0.3
140 0.37
141 0.41
142 0.51
143 0.58
144 0.64
145 0.7
146 0.71
147 0.7
148 0.64
149 0.59
150 0.5
151 0.45
152 0.37
153 0.29
154 0.24
155 0.17
156 0.14
157 0.11
158 0.09
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07