Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8E3U8

Protein Details
Accession S8E3U8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
262-283DLLQWEERRRRLRRTGSMETVRHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
Amino Acid Sequences DDITLETSLQDPSVDIEAVLLAWEELHPYSVDAVTTQRSEIFDFATSDECIMFASIQLKVTMPVQSDGTEEGDGEVAEESTFPSPSHLRSYVRTILRKVDAYSPTTTADEAVKVPVGEPSEVRTVTTIHTVGILYLRKTEMLTEYNIGLVIHPEWRGQNLAEKVLTKGLAHAFNNLWAHRVQALIMDGPSSDAARSIFVSLGFTFEGTRRRAIMSPAVEGGYRDVVAMAMLDTEWHVRESGGHGQRGVWDEMFVRHHKEQEDLLQWEERRRRLRRTGSMETVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.09
5 0.09
6 0.09
7 0.06
8 0.04
9 0.04
10 0.04
11 0.06
12 0.06
13 0.07
14 0.08
15 0.08
16 0.1
17 0.1
18 0.1
19 0.09
20 0.12
21 0.14
22 0.14
23 0.14
24 0.15
25 0.16
26 0.17
27 0.17
28 0.17
29 0.15
30 0.16
31 0.16
32 0.16
33 0.15
34 0.14
35 0.13
36 0.11
37 0.09
38 0.09
39 0.08
40 0.07
41 0.09
42 0.09
43 0.1
44 0.11
45 0.11
46 0.11
47 0.13
48 0.14
49 0.14
50 0.14
51 0.14
52 0.14
53 0.15
54 0.15
55 0.15
56 0.13
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.07
70 0.1
71 0.11
72 0.13
73 0.19
74 0.21
75 0.22
76 0.25
77 0.31
78 0.36
79 0.41
80 0.42
81 0.39
82 0.4
83 0.41
84 0.4
85 0.35
86 0.35
87 0.31
88 0.31
89 0.3
90 0.27
91 0.25
92 0.24
93 0.22
94 0.16
95 0.14
96 0.11
97 0.1
98 0.09
99 0.08
100 0.08
101 0.08
102 0.09
103 0.09
104 0.09
105 0.09
106 0.11
107 0.13
108 0.13
109 0.13
110 0.12
111 0.12
112 0.12
113 0.14
114 0.11
115 0.08
116 0.09
117 0.09
118 0.08
119 0.1
120 0.11
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.09
128 0.09
129 0.1
130 0.1
131 0.1
132 0.1
133 0.1
134 0.09
135 0.07
136 0.06
137 0.05
138 0.06
139 0.07
140 0.07
141 0.07
142 0.08
143 0.1
144 0.09
145 0.15
146 0.14
147 0.16
148 0.16
149 0.16
150 0.16
151 0.16
152 0.17
153 0.1
154 0.11
155 0.13
156 0.16
157 0.16
158 0.17
159 0.16
160 0.2
161 0.22
162 0.19
163 0.18
164 0.14
165 0.15
166 0.13
167 0.13
168 0.09
169 0.08
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.07
176 0.08
177 0.07
178 0.05
179 0.06
180 0.06
181 0.07
182 0.08
183 0.08
184 0.08
185 0.08
186 0.1
187 0.09
188 0.1
189 0.09
190 0.09
191 0.09
192 0.11
193 0.17
194 0.16
195 0.18
196 0.18
197 0.2
198 0.22
199 0.24
200 0.29
201 0.25
202 0.25
203 0.25
204 0.25
205 0.22
206 0.21
207 0.19
208 0.13
209 0.11
210 0.09
211 0.08
212 0.07
213 0.07
214 0.07
215 0.05
216 0.04
217 0.04
218 0.04
219 0.05
220 0.06
221 0.07
222 0.08
223 0.08
224 0.08
225 0.09
226 0.14
227 0.23
228 0.27
229 0.28
230 0.27
231 0.28
232 0.32
233 0.34
234 0.32
235 0.23
236 0.18
237 0.18
238 0.22
239 0.26
240 0.25
241 0.28
242 0.29
243 0.33
244 0.33
245 0.35
246 0.34
247 0.37
248 0.41
249 0.37
250 0.37
251 0.39
252 0.4
253 0.46
254 0.49
255 0.5
256 0.53
257 0.57
258 0.64
259 0.68
260 0.77
261 0.78
262 0.8
263 0.82