Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8E6D1

Protein Details
Accession S8E6D1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
185-210ADGQPVKRPRGRPKGSKTNKGKAKEGBasic
NLS Segment(s)
PositionSequence
190-210VKRPRGRPKGSKTNKGKAKEG
Subcellular Location(s) nucl 15.5, cyto_nucl 11.833, mito_nucl 11.832, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
Pfam View protein in Pfam  
PF10146  zf-C4H2  
Amino Acid Sequences MATGAAAASSAPSSSTPSQPVLASGDWTKNLVHLAKTAELKKHALTLQLHTAHILSAHASLDQKQKAIQDVKEQKNKLESERARLLNCLREVNEDRDKADLLEATLDKECADLRQKIQTISDTEYATAKADVDRLRRELGQPPLPSLQQTLEDKSAQYLKELRLQTEKTNAATKRTAEDGPAAGADGQPVKRPRGRPKGSKTNKGKAKEGGPTGTPAPGSAPSVAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.22
4 0.24
5 0.26
6 0.25
7 0.26
8 0.24
9 0.21
10 0.21
11 0.21
12 0.22
13 0.21
14 0.22
15 0.2
16 0.17
17 0.21
18 0.2
19 0.18
20 0.18
21 0.2
22 0.24
23 0.29
24 0.32
25 0.33
26 0.34
27 0.35
28 0.33
29 0.34
30 0.31
31 0.32
32 0.3
33 0.3
34 0.35
35 0.34
36 0.34
37 0.29
38 0.28
39 0.22
40 0.2
41 0.16
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.12
48 0.19
49 0.2
50 0.19
51 0.2
52 0.22
53 0.27
54 0.31
55 0.29
56 0.33
57 0.42
58 0.5
59 0.56
60 0.56
61 0.51
62 0.53
63 0.53
64 0.46
65 0.46
66 0.4
67 0.39
68 0.46
69 0.46
70 0.4
71 0.41
72 0.39
73 0.35
74 0.35
75 0.29
76 0.22
77 0.26
78 0.28
79 0.32
80 0.36
81 0.31
82 0.3
83 0.28
84 0.28
85 0.22
86 0.2
87 0.13
88 0.07
89 0.09
90 0.08
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.11
99 0.12
100 0.13
101 0.18
102 0.19
103 0.2
104 0.21
105 0.21
106 0.19
107 0.21
108 0.22
109 0.17
110 0.16
111 0.16
112 0.16
113 0.14
114 0.12
115 0.09
116 0.06
117 0.1
118 0.13
119 0.16
120 0.18
121 0.19
122 0.21
123 0.22
124 0.24
125 0.26
126 0.3
127 0.33
128 0.31
129 0.32
130 0.32
131 0.32
132 0.3
133 0.25
134 0.19
135 0.18
136 0.19
137 0.19
138 0.19
139 0.2
140 0.19
141 0.2
142 0.23
143 0.18
144 0.18
145 0.19
146 0.19
147 0.26
148 0.27
149 0.27
150 0.3
151 0.33
152 0.33
153 0.36
154 0.36
155 0.31
156 0.38
157 0.37
158 0.35
159 0.36
160 0.34
161 0.3
162 0.31
163 0.29
164 0.23
165 0.25
166 0.21
167 0.18
168 0.17
169 0.14
170 0.11
171 0.1
172 0.1
173 0.12
174 0.12
175 0.17
176 0.21
177 0.26
178 0.32
179 0.41
180 0.5
181 0.58
182 0.66
183 0.7
184 0.77
185 0.83
186 0.87
187 0.89
188 0.88
189 0.87
190 0.86
191 0.81
192 0.77
193 0.72
194 0.69
195 0.66
196 0.62
197 0.56
198 0.49
199 0.47
200 0.42
201 0.37
202 0.31
203 0.23
204 0.2
205 0.18
206 0.19
207 0.16