Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8G233

Protein Details
Accession S8G233    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
418-444ERSDRPIQKTHGRRKSKGKAKEGTVEEBasic
NLS Segment(s)
PositionSequence
426-438KTHGRRKSKGKAK
Subcellular Location(s) cyto 8.5, mito 8, cyto_nucl 5.5, plas 2, extr 2, pero 2, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00153  Mito_carr  
Amino Acid Sequences MTTPPTSLRDFYATPSNAWSFVPANLPGTPENASDLYSSAANSSSYEWSTRTNLNPLFDLSASYGVNEDGVDVKLVLQGLVTAALSSYASQALTMPFEVGKTLLQVQWIPRDTEELISGGPSTFDPVDDEEELSDSSNDNEAYFADPSKLEAEGETLPPPRIADERGYVVRQSVLDEGTTPEYVMPVGYADGTWGMIKQLGRFRSEGWLSLWKGLLTTTVHEALYSSLQPACHTILQYAFAPAFPSLSSTSSSVILPVASHTLAGFILSPLQLVRTRLIIQSSHPRFRTYSGPIDALSHILAEEGGLHGVYLHPHLLIPTLLEHTLRGLIPLTLPALIASYIGFGTQLSPDMHPVLWNVAELLGDFAGSLIMLPIETVRRRLQAQVRGTAKPLRACVEVRPAPYNGVVDALWHIITEERSDRPIQKTHGRRKSKGKAKEGTVEEEEEQRSWLRSTGIGQLYRGLGVRLAVGFTVFVLASLSDKESDGGWAEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.34
4 0.3
5 0.29
6 0.29
7 0.21
8 0.21
9 0.24
10 0.2
11 0.22
12 0.21
13 0.24
14 0.21
15 0.22
16 0.22
17 0.19
18 0.21
19 0.18
20 0.18
21 0.16
22 0.16
23 0.15
24 0.14
25 0.13
26 0.1
27 0.11
28 0.1
29 0.11
30 0.13
31 0.15
32 0.16
33 0.17
34 0.18
35 0.2
36 0.24
37 0.28
38 0.29
39 0.34
40 0.36
41 0.37
42 0.37
43 0.35
44 0.34
45 0.29
46 0.27
47 0.2
48 0.2
49 0.17
50 0.16
51 0.14
52 0.11
53 0.12
54 0.1
55 0.09
56 0.07
57 0.08
58 0.08
59 0.07
60 0.08
61 0.09
62 0.09
63 0.08
64 0.07
65 0.06
66 0.06
67 0.07
68 0.06
69 0.05
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.11
91 0.12
92 0.15
93 0.17
94 0.24
95 0.26
96 0.25
97 0.23
98 0.26
99 0.25
100 0.24
101 0.22
102 0.15
103 0.13
104 0.12
105 0.12
106 0.09
107 0.08
108 0.07
109 0.09
110 0.08
111 0.08
112 0.09
113 0.1
114 0.14
115 0.14
116 0.14
117 0.12
118 0.13
119 0.13
120 0.12
121 0.11
122 0.08
123 0.08
124 0.1
125 0.09
126 0.08
127 0.08
128 0.08
129 0.1
130 0.11
131 0.1
132 0.09
133 0.09
134 0.11
135 0.11
136 0.11
137 0.09
138 0.08
139 0.11
140 0.11
141 0.12
142 0.14
143 0.14
144 0.14
145 0.15
146 0.15
147 0.13
148 0.14
149 0.14
150 0.15
151 0.16
152 0.19
153 0.21
154 0.22
155 0.21
156 0.19
157 0.19
158 0.16
159 0.15
160 0.12
161 0.1
162 0.09
163 0.1
164 0.11
165 0.12
166 0.11
167 0.1
168 0.08
169 0.08
170 0.08
171 0.07
172 0.06
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.07
184 0.07
185 0.11
186 0.16
187 0.17
188 0.19
189 0.2
190 0.21
191 0.24
192 0.24
193 0.22
194 0.2
195 0.25
196 0.23
197 0.24
198 0.24
199 0.18
200 0.17
201 0.16
202 0.15
203 0.09
204 0.1
205 0.1
206 0.11
207 0.11
208 0.11
209 0.11
210 0.09
211 0.1
212 0.09
213 0.08
214 0.08
215 0.08
216 0.08
217 0.1
218 0.11
219 0.1
220 0.11
221 0.1
222 0.1
223 0.11
224 0.11
225 0.1
226 0.09
227 0.08
228 0.08
229 0.07
230 0.07
231 0.05
232 0.07
233 0.07
234 0.09
235 0.1
236 0.1
237 0.11
238 0.11
239 0.11
240 0.09
241 0.09
242 0.07
243 0.06
244 0.06
245 0.06
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.04
254 0.05
255 0.04
256 0.05
257 0.04
258 0.06
259 0.08
260 0.09
261 0.09
262 0.11
263 0.12
264 0.13
265 0.15
266 0.14
267 0.15
268 0.24
269 0.29
270 0.34
271 0.33
272 0.34
273 0.33
274 0.35
275 0.38
276 0.33
277 0.34
278 0.3
279 0.3
280 0.29
281 0.29
282 0.27
283 0.22
284 0.17
285 0.1
286 0.07
287 0.06
288 0.06
289 0.04
290 0.04
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.04
297 0.04
298 0.05
299 0.05
300 0.05
301 0.05
302 0.06
303 0.06
304 0.06
305 0.06
306 0.07
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.1
313 0.09
314 0.09
315 0.08
316 0.07
317 0.08
318 0.08
319 0.08
320 0.06
321 0.07
322 0.06
323 0.06
324 0.06
325 0.06
326 0.05
327 0.05
328 0.05
329 0.05
330 0.05
331 0.04
332 0.05
333 0.05
334 0.08
335 0.09
336 0.09
337 0.11
338 0.13
339 0.13
340 0.12
341 0.13
342 0.12
343 0.11
344 0.1
345 0.09
346 0.08
347 0.08
348 0.07
349 0.07
350 0.05
351 0.05
352 0.05
353 0.04
354 0.04
355 0.04
356 0.03
357 0.02
358 0.03
359 0.03
360 0.03
361 0.04
362 0.09
363 0.1
364 0.14
365 0.17
366 0.2
367 0.22
368 0.3
369 0.37
370 0.41
371 0.45
372 0.5
373 0.51
374 0.5
375 0.52
376 0.5
377 0.46
378 0.41
379 0.39
380 0.34
381 0.33
382 0.33
383 0.34
384 0.38
385 0.38
386 0.38
387 0.38
388 0.36
389 0.34
390 0.34
391 0.31
392 0.21
393 0.18
394 0.15
395 0.12
396 0.13
397 0.12
398 0.1
399 0.09
400 0.09
401 0.09
402 0.1
403 0.13
404 0.15
405 0.15
406 0.19
407 0.23
408 0.28
409 0.31
410 0.37
411 0.4
412 0.47
413 0.56
414 0.64
415 0.71
416 0.75
417 0.77
418 0.82
419 0.87
420 0.86
421 0.86
422 0.85
423 0.83
424 0.8
425 0.81
426 0.74
427 0.7
428 0.63
429 0.56
430 0.48
431 0.44
432 0.4
433 0.31
434 0.28
435 0.23
436 0.22
437 0.2
438 0.2
439 0.17
440 0.17
441 0.19
442 0.27
443 0.32
444 0.31
445 0.31
446 0.32
447 0.31
448 0.31
449 0.28
450 0.2
451 0.14
452 0.13
453 0.14
454 0.11
455 0.11
456 0.1
457 0.09
458 0.09
459 0.08
460 0.09
461 0.07
462 0.06
463 0.06
464 0.07
465 0.08
466 0.09
467 0.11
468 0.1
469 0.11
470 0.12
471 0.12
472 0.13