Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DHW6

Protein Details
Accession S8DHW6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-78GPPPAKRARVDRRKNSKSASHydrophilic
NLS Segment(s)
PositionSequence
32-75RRKNPSRAAAKQAKSNSPSRASSSRPEGPPPAKRARVDRRKNSK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDVDQRTSSLSPVPEDTPMDEVDTQPQEGASRRKNPSRAAAKQAKSNSPSRASSSRPEGPPPAKRARVDRRKNSKSASSAFDAEDEDDDGPAAANAASAPSRRTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.2
5 0.19
6 0.2
7 0.17
8 0.16
9 0.19
10 0.19
11 0.18
12 0.15
13 0.15
14 0.14
15 0.18
16 0.25
17 0.26
18 0.34
19 0.39
20 0.46
21 0.5
22 0.52
23 0.57
24 0.6
25 0.58
26 0.58
27 0.62
28 0.57
29 0.59
30 0.59
31 0.54
32 0.48
33 0.48
34 0.43
35 0.38
36 0.38
37 0.36
38 0.35
39 0.33
40 0.33
41 0.34
42 0.36
43 0.33
44 0.34
45 0.35
46 0.37
47 0.4
48 0.43
49 0.45
50 0.44
51 0.45
52 0.52
53 0.58
54 0.63
55 0.68
56 0.72
57 0.76
58 0.77
59 0.8
60 0.75
61 0.71
62 0.66
63 0.6
64 0.53
65 0.46
66 0.41
67 0.36
68 0.32
69 0.26
70 0.21
71 0.18
72 0.15
73 0.11
74 0.09
75 0.09
76 0.08
77 0.07
78 0.06
79 0.06
80 0.04
81 0.04
82 0.04
83 0.06
84 0.08
85 0.09
86 0.12