Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EDS4

Protein Details
Accession S8EDS4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-44TYSRKRASAEKKRTVRAQKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
Gene Ontology GO:0006413  P:translational initiation  
Amino Acid Sequences RKKFYVQLVRAEPEPIVKLIRASDTYSRKRASAEKKRTVRAQKEVQLSWAISEADLEHKFEKVREELEIGNRVDLAYLHKSGQTIPTREEMAVRAEETLKALEDAGAPWKPLTLTKTSLILHLQGHNEPSAPGTPNLRAHMAEQAEKKLERRQKDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.23
3 0.19
4 0.16
5 0.17
6 0.17
7 0.21
8 0.19
9 0.21
10 0.28
11 0.36
12 0.42
13 0.47
14 0.47
15 0.44
16 0.46
17 0.51
18 0.53
19 0.55
20 0.59
21 0.63
22 0.69
23 0.74
24 0.8
25 0.8
26 0.77
27 0.75
28 0.73
29 0.69
30 0.69
31 0.63
32 0.56
33 0.48
34 0.4
35 0.32
36 0.25
37 0.18
38 0.11
39 0.11
40 0.09
41 0.12
42 0.12
43 0.14
44 0.12
45 0.13
46 0.14
47 0.14
48 0.17
49 0.14
50 0.14
51 0.13
52 0.15
53 0.15
54 0.18
55 0.22
56 0.19
57 0.18
58 0.17
59 0.15
60 0.13
61 0.12
62 0.12
63 0.09
64 0.1
65 0.11
66 0.11
67 0.12
68 0.12
69 0.19
70 0.2
71 0.19
72 0.2
73 0.21
74 0.22
75 0.22
76 0.22
77 0.16
78 0.14
79 0.13
80 0.12
81 0.11
82 0.1
83 0.1
84 0.1
85 0.1
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.12
99 0.15
100 0.15
101 0.18
102 0.19
103 0.24
104 0.24
105 0.26
106 0.24
107 0.23
108 0.22
109 0.22
110 0.23
111 0.2
112 0.21
113 0.19
114 0.19
115 0.16
116 0.16
117 0.15
118 0.15
119 0.16
120 0.18
121 0.22
122 0.26
123 0.29
124 0.29
125 0.27
126 0.26
127 0.31
128 0.31
129 0.32
130 0.31
131 0.33
132 0.36
133 0.37
134 0.39
135 0.41
136 0.46
137 0.48