Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DX13

Protein Details
Accession S8DX13   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
133-155NPPAGRRRRGGYPPRTRPPRPDDBasic
NLS Segment(s)
PositionSequence
134-154PPAGRRRRGGYPPRTRPPRPD
Subcellular Location(s) nucl 18, cyto 4, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR011016  Znf_RING-CH  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16454  RING-H2_PA-TM-RING  
Amino Acid Sequences MDLGDDPLRDEDLDTSYEALMELSGLLGEVRPRGLSEQAIASLPSGTYSEWATPGETEERCPICLDDYNPEDPVLKLPACSHWFHRGCLEQWLKSARTCPVCRGRVGSSDARHGLRPSGSASSAGPSAGPSANPPAGRRRRGGYPPRTRPPRPDDRREGGNDSDGDVPPFPLPPWRYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.12
5 0.11
6 0.09
7 0.07
8 0.06
9 0.05
10 0.04
11 0.03
12 0.03
13 0.03
14 0.04
15 0.05
16 0.06
17 0.07
18 0.07
19 0.08
20 0.1
21 0.12
22 0.13
23 0.13
24 0.14
25 0.14
26 0.15
27 0.14
28 0.12
29 0.1
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.1
39 0.1
40 0.09
41 0.11
42 0.14
43 0.14
44 0.15
45 0.19
46 0.2
47 0.2
48 0.2
49 0.19
50 0.17
51 0.19
52 0.19
53 0.18
54 0.2
55 0.21
56 0.21
57 0.21
58 0.19
59 0.17
60 0.17
61 0.15
62 0.11
63 0.1
64 0.1
65 0.15
66 0.17
67 0.18
68 0.2
69 0.27
70 0.28
71 0.29
72 0.31
73 0.28
74 0.26
75 0.33
76 0.32
77 0.23
78 0.24
79 0.27
80 0.25
81 0.23
82 0.25
83 0.21
84 0.26
85 0.26
86 0.31
87 0.36
88 0.37
89 0.38
90 0.39
91 0.37
92 0.34
93 0.38
94 0.36
95 0.29
96 0.31
97 0.33
98 0.3
99 0.3
100 0.26
101 0.24
102 0.19
103 0.18
104 0.16
105 0.15
106 0.14
107 0.14
108 0.14
109 0.13
110 0.13
111 0.12
112 0.09
113 0.08
114 0.09
115 0.09
116 0.08
117 0.08
118 0.13
119 0.16
120 0.17
121 0.19
122 0.28
123 0.36
124 0.4
125 0.42
126 0.42
127 0.47
128 0.56
129 0.64
130 0.65
131 0.68
132 0.73
133 0.81
134 0.86
135 0.81
136 0.8
137 0.79
138 0.8
139 0.78
140 0.78
141 0.76
142 0.74
143 0.77
144 0.73
145 0.7
146 0.61
147 0.57
148 0.47
149 0.4
150 0.38
151 0.31
152 0.28
153 0.23
154 0.21
155 0.17
156 0.18
157 0.16
158 0.2