Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8FP46

Protein Details
Accession S8FP46    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRILGHKRAKRNTRPNTSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRILGHKRAKRNTRPNTSLVQIEGVATKEDAQFYLGKRLAYVYHAKREIQGSKVRVIWGRVTRPHGNSGVVKAKFRSNIPPHAFGASVRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.18
35 0.17
36 0.18
37 0.25
38 0.2
39 0.25
40 0.26
41 0.26
42 0.27
43 0.31
44 0.3
45 0.27
46 0.29
47 0.26
48 0.27
49 0.28
50 0.28
51 0.26
52 0.26
53 0.28
54 0.28
55 0.31
56 0.33
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.33
64 0.35
65 0.37
66 0.33
67 0.33
68 0.31
69 0.34
70 0.34
71 0.35
72 0.39
73 0.37
74 0.46
75 0.49
76 0.52
77 0.49
78 0.47
79 0.45
80 0.35
81 0.34
82 0.25
83 0.2
84 0.16
85 0.15
86 0.13