Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PCD3

Protein Details
Accession A0A1D8PCD3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
121-146GWDHYVQEPKKRHFRKKDYSANFYHSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.833, cyto_mito 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006885  NADH_UbQ_FeS_4_mit-like  
IPR038532  NDUFS4-like_sf  
Gene Ontology GO:0005747  C:mitochondrial respiratory chain complex I  
GO:0005886  C:plasma membrane  
GO:0022900  P:electron transport chain  
KEGG cal:CAALFM_C101010WA  -  
Pfam View protein in Pfam  
PF04800  NDUS4  
Amino Acid Sequences MLSRVSIRSLPLCTRTFATTSILKQSELTAATDSSGKEIVSGAPRELVTERVVRIYQEAKPATQSGHHNGSHWKLDWDVLGKGNRWENDLMGYQGSADYMQGTIMKFDTKESAIKFAENQGWDHYVQEPKKRHFRKKDYSANFYHSAGPLKHIRTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.28
5 0.28
6 0.26
7 0.27
8 0.33
9 0.31
10 0.29
11 0.28
12 0.27
13 0.26
14 0.23
15 0.22
16 0.15
17 0.14
18 0.14
19 0.15
20 0.14
21 0.12
22 0.12
23 0.1
24 0.09
25 0.1
26 0.11
27 0.14
28 0.15
29 0.14
30 0.15
31 0.16
32 0.17
33 0.17
34 0.16
35 0.14
36 0.15
37 0.15
38 0.16
39 0.16
40 0.15
41 0.16
42 0.18
43 0.17
44 0.22
45 0.23
46 0.2
47 0.22
48 0.22
49 0.2
50 0.21
51 0.23
52 0.2
53 0.25
54 0.25
55 0.25
56 0.27
57 0.29
58 0.27
59 0.24
60 0.2
61 0.14
62 0.15
63 0.14
64 0.14
65 0.12
66 0.13
67 0.14
68 0.14
69 0.16
70 0.19
71 0.18
72 0.18
73 0.18
74 0.15
75 0.16
76 0.16
77 0.14
78 0.1
79 0.1
80 0.08
81 0.07
82 0.07
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.09
95 0.11
96 0.11
97 0.15
98 0.15
99 0.2
100 0.2
101 0.21
102 0.21
103 0.23
104 0.26
105 0.23
106 0.23
107 0.2
108 0.22
109 0.21
110 0.22
111 0.22
112 0.25
113 0.28
114 0.36
115 0.41
116 0.46
117 0.57
118 0.66
119 0.73
120 0.76
121 0.82
122 0.85
123 0.88
124 0.91
125 0.89
126 0.87
127 0.81
128 0.77
129 0.69
130 0.6
131 0.52
132 0.44
133 0.41
134 0.34
135 0.34
136 0.34