Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8FZI6

Protein Details
Accession S8FZI6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-123AAQSKAAKKNEKRKEKRKEKRDTEKVKDSWBasic
NLS Segment(s)
PositionSequence
96-115QSKAAKKNEKRKEKRKEKRD
Subcellular Location(s) cyto 11.5, cyto_nucl 9, nucl 5.5, mito 4, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSKPAIVPDTTVAGIAVDPRTLERVIPESRRPDGSVRKQIKIRPGFTPQEDVRRFRGTRQQQAEATALPKGHIIGWAPPPTSTAPKPGAAASAAAQSKAAKKNEKRKEKRKEKRDTEKVKDSWEDEDEEVSGTGAQDGSHSADSPNWAAAPETKKSVAVREKGENGTPTTPPPAEGGDELTEKLEKLEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.09
5 0.09
6 0.1
7 0.13
8 0.13
9 0.13
10 0.13
11 0.18
12 0.24
13 0.29
14 0.35
15 0.38
16 0.41
17 0.43
18 0.43
19 0.45
20 0.49
21 0.53
22 0.58
23 0.58
24 0.61
25 0.63
26 0.65
27 0.68
28 0.65
29 0.58
30 0.53
31 0.55
32 0.54
33 0.52
34 0.55
35 0.47
36 0.49
37 0.5
38 0.48
39 0.45
40 0.47
41 0.45
42 0.42
43 0.49
44 0.48
45 0.54
46 0.56
47 0.57
48 0.5
49 0.53
50 0.49
51 0.4
52 0.32
53 0.24
54 0.18
55 0.13
56 0.12
57 0.1
58 0.09
59 0.09
60 0.09
61 0.11
62 0.15
63 0.18
64 0.18
65 0.17
66 0.19
67 0.19
68 0.22
69 0.2
70 0.2
71 0.2
72 0.2
73 0.21
74 0.19
75 0.18
76 0.15
77 0.14
78 0.1
79 0.12
80 0.11
81 0.1
82 0.11
83 0.11
84 0.15
85 0.2
86 0.23
87 0.27
88 0.34
89 0.45
90 0.54
91 0.65
92 0.71
93 0.76
94 0.83
95 0.87
96 0.9
97 0.9
98 0.92
99 0.91
100 0.92
101 0.92
102 0.91
103 0.88
104 0.87
105 0.78
106 0.71
107 0.63
108 0.53
109 0.46
110 0.37
111 0.32
112 0.22
113 0.21
114 0.17
115 0.15
116 0.13
117 0.1
118 0.08
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.05
125 0.08
126 0.08
127 0.09
128 0.09
129 0.1
130 0.12
131 0.12
132 0.12
133 0.1
134 0.1
135 0.1
136 0.15
137 0.19
138 0.19
139 0.21
140 0.22
141 0.25
142 0.25
143 0.33
144 0.36
145 0.37
146 0.4
147 0.43
148 0.48
149 0.48
150 0.51
151 0.45
152 0.41
153 0.38
154 0.35
155 0.31
156 0.31
157 0.28
158 0.25
159 0.24
160 0.22
161 0.21
162 0.21
163 0.22
164 0.19
165 0.2
166 0.2
167 0.2
168 0.18
169 0.16