Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8F0N9

Protein Details
Accession S8F0N9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-72ATLPRATRARSKPRTLTCPRYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 9.166, nucl 9, mito 9, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MGDEHRVHGARHWTIPPYVTRGNLDTRHVTVCATLSTCPPRRTLHDSPWKTATLPRATRARSKPRTLTCPRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.31
4 0.3
5 0.29
6 0.26
7 0.26
8 0.26
9 0.3
10 0.3
11 0.31
12 0.27
13 0.27
14 0.26
15 0.24
16 0.22
17 0.16
18 0.14
19 0.11
20 0.1
21 0.09
22 0.1
23 0.17
24 0.22
25 0.22
26 0.24
27 0.26
28 0.31
29 0.39
30 0.42
31 0.45
32 0.51
33 0.54
34 0.54
35 0.55
36 0.51
37 0.43
38 0.41
39 0.38
40 0.37
41 0.37
42 0.39
43 0.43
44 0.45
45 0.54
46 0.6
47 0.64
48 0.63
49 0.69
50 0.73
51 0.74
52 0.81