Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DPS8

Protein Details
Accession S8DPS8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-76AEMSTSGKKRGKNKRKPRAAPSSSGQSKPSKRKPNRWADKCMYAEHydrophilic
NLS Segment(s)
PositionSequence
38-67GKKRGKNKRKPRAAPSSSGQSKPSKRKPNR
Subcellular Location(s) nucl 9, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR017336  Snurportin-1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0061015  P:snRNA import into nucleus  
Amino Acid Sequences MLPTAQEIASTSGSTAPPAITSESAVPDPQTAEMSTSGKKRGKNKRKPRAAPSSSGQSKPSKRKPNRWADKCMYAELLEMSEDHGPDIVADGIPHDIETGWVAVAPVPVGKRCLAVTHQTSGIPGVVPNLTLRSRVLGKPLMKAFPSPLPPHTVLDCILDEHWRENGVLHVLDVLKWKEQDITECETPFRFWWRDTRLSELPILPPPADAADAEGGAAMHAQYRFPHPATLVPVPYHTNTSLAHLLHTLIPLTRAPRTVMVTKRAVPSPHAAGMYRKSAADLETVPVQLRSDGLLLYVAQATYEPGTSPLSSWVPLETYSSAKEDVEMAEVALESPLRVFERLVRRRLAMQEGASVIPEVNMEEEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.12
5 0.14
6 0.16
7 0.13
8 0.15
9 0.16
10 0.18
11 0.19
12 0.19
13 0.18
14 0.17
15 0.17
16 0.16
17 0.16
18 0.13
19 0.14
20 0.16
21 0.18
22 0.21
23 0.24
24 0.32
25 0.35
26 0.4
27 0.48
28 0.57
29 0.66
30 0.72
31 0.8
32 0.82
33 0.89
34 0.93
35 0.93
36 0.93
37 0.87
38 0.82
39 0.77
40 0.77
41 0.71
42 0.64
43 0.59
44 0.56
45 0.6
46 0.64
47 0.68
48 0.69
49 0.73
50 0.81
51 0.87
52 0.9
53 0.92
54 0.88
55 0.88
56 0.83
57 0.82
58 0.74
59 0.65
60 0.55
61 0.44
62 0.37
63 0.28
64 0.22
65 0.13
66 0.11
67 0.1
68 0.1
69 0.1
70 0.09
71 0.08
72 0.07
73 0.07
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.06
83 0.05
84 0.05
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.08
95 0.09
96 0.11
97 0.11
98 0.11
99 0.12
100 0.14
101 0.15
102 0.21
103 0.23
104 0.24
105 0.25
106 0.23
107 0.23
108 0.21
109 0.19
110 0.12
111 0.09
112 0.08
113 0.07
114 0.07
115 0.08
116 0.1
117 0.1
118 0.11
119 0.11
120 0.12
121 0.15
122 0.16
123 0.2
124 0.23
125 0.24
126 0.29
127 0.31
128 0.31
129 0.28
130 0.28
131 0.26
132 0.25
133 0.28
134 0.24
135 0.23
136 0.26
137 0.27
138 0.28
139 0.26
140 0.23
141 0.18
142 0.18
143 0.17
144 0.12
145 0.11
146 0.11
147 0.11
148 0.11
149 0.1
150 0.09
151 0.09
152 0.08
153 0.09
154 0.09
155 0.08
156 0.07
157 0.08
158 0.08
159 0.08
160 0.11
161 0.11
162 0.11
163 0.11
164 0.11
165 0.12
166 0.12
167 0.14
168 0.15
169 0.2
170 0.2
171 0.2
172 0.21
173 0.19
174 0.19
175 0.17
176 0.19
177 0.15
178 0.14
179 0.21
180 0.27
181 0.34
182 0.34
183 0.4
184 0.37
185 0.37
186 0.38
187 0.32
188 0.28
189 0.23
190 0.23
191 0.16
192 0.14
193 0.12
194 0.11
195 0.1
196 0.08
197 0.07
198 0.06
199 0.06
200 0.06
201 0.06
202 0.05
203 0.04
204 0.04
205 0.03
206 0.05
207 0.05
208 0.06
209 0.07
210 0.11
211 0.14
212 0.15
213 0.16
214 0.15
215 0.17
216 0.22
217 0.24
218 0.22
219 0.19
220 0.2
221 0.22
222 0.22
223 0.21
224 0.17
225 0.16
226 0.14
227 0.18
228 0.2
229 0.18
230 0.17
231 0.15
232 0.16
233 0.15
234 0.15
235 0.11
236 0.08
237 0.09
238 0.1
239 0.12
240 0.13
241 0.13
242 0.14
243 0.17
244 0.21
245 0.27
246 0.3
247 0.34
248 0.36
249 0.38
250 0.4
251 0.41
252 0.38
253 0.34
254 0.34
255 0.32
256 0.32
257 0.29
258 0.26
259 0.26
260 0.29
261 0.29
262 0.26
263 0.22
264 0.19
265 0.19
266 0.19
267 0.18
268 0.15
269 0.14
270 0.15
271 0.16
272 0.15
273 0.15
274 0.14
275 0.12
276 0.11
277 0.1
278 0.08
279 0.08
280 0.08
281 0.08
282 0.07
283 0.08
284 0.09
285 0.07
286 0.07
287 0.07
288 0.08
289 0.08
290 0.08
291 0.07
292 0.08
293 0.11
294 0.11
295 0.12
296 0.15
297 0.16
298 0.16
299 0.16
300 0.16
301 0.15
302 0.15
303 0.18
304 0.15
305 0.16
306 0.17
307 0.19
308 0.19
309 0.17
310 0.17
311 0.16
312 0.15
313 0.15
314 0.13
315 0.11
316 0.1
317 0.1
318 0.1
319 0.09
320 0.08
321 0.05
322 0.06
323 0.08
324 0.1
325 0.1
326 0.11
327 0.19
328 0.3
329 0.38
330 0.43
331 0.45
332 0.46
333 0.51
334 0.55
335 0.54
336 0.49
337 0.43
338 0.41
339 0.39
340 0.37
341 0.32
342 0.27
343 0.2
344 0.15
345 0.13
346 0.09