Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EFN3

Protein Details
Accession S8EFN3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
126-154RRLVARMIKDDRRKRHRRRKETDNLVAAFBasic
NLS Segment(s)
PositionSequence
131-145RMIKDDRRKRHRRRK
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MRTIVAPATQARDPFRDISVKVHIRRPDRDSWTYLGRGLISQEQSRIVVRSAASHKVMTTFGEEAPLQAEKRGSFVVVGCVEGTRVVSWSFNAQSNSETLRLLACIQLTCDSRRYPANSPQLSAHRRLVARMIKDDRRKRHRRRKETDNLVAAFERTGLDSTPADQSMAAAEPIAVQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.3
5 0.31
6 0.38
7 0.43
8 0.43
9 0.48
10 0.52
11 0.54
12 0.59
13 0.6
14 0.6
15 0.59
16 0.6
17 0.57
18 0.54
19 0.52
20 0.47
21 0.42
22 0.34
23 0.26
24 0.22
25 0.21
26 0.21
27 0.19
28 0.19
29 0.19
30 0.19
31 0.2
32 0.2
33 0.19
34 0.15
35 0.14
36 0.13
37 0.18
38 0.2
39 0.23
40 0.24
41 0.23
42 0.22
43 0.21
44 0.22
45 0.17
46 0.16
47 0.13
48 0.11
49 0.13
50 0.13
51 0.11
52 0.12
53 0.13
54 0.1
55 0.1
56 0.12
57 0.09
58 0.11
59 0.11
60 0.1
61 0.09
62 0.09
63 0.12
64 0.11
65 0.11
66 0.09
67 0.09
68 0.09
69 0.08
70 0.08
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.08
77 0.09
78 0.11
79 0.12
80 0.12
81 0.12
82 0.13
83 0.15
84 0.13
85 0.12
86 0.09
87 0.09
88 0.09
89 0.09
90 0.08
91 0.07
92 0.06
93 0.07
94 0.11
95 0.12
96 0.14
97 0.16
98 0.16
99 0.17
100 0.21
101 0.25
102 0.27
103 0.34
104 0.42
105 0.4
106 0.41
107 0.44
108 0.48
109 0.47
110 0.46
111 0.4
112 0.36
113 0.35
114 0.34
115 0.38
116 0.35
117 0.35
118 0.38
119 0.42
120 0.45
121 0.55
122 0.63
123 0.66
124 0.72
125 0.8
126 0.83
127 0.88
128 0.91
129 0.92
130 0.92
131 0.93
132 0.93
133 0.92
134 0.9
135 0.86
136 0.76
137 0.67
138 0.58
139 0.48
140 0.37
141 0.27
142 0.18
143 0.11
144 0.11
145 0.09
146 0.11
147 0.11
148 0.13
149 0.16
150 0.16
151 0.15
152 0.14
153 0.14
154 0.13
155 0.14
156 0.12
157 0.08
158 0.08