Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8EM78

Protein Details
Accession S8EM78   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-118PAQFAHPPKPRKKIRGHGPAVQNHydrophilic
NLS Segment(s)
PositionSequence
102-127PPKPRKKIRGHGPAVQNGKRIRSKRR
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MSSWLAFKPISLIPRFCRTLVNKAALRPVPAATGPISTPESFLKAIGRSADTKVKAESWEDLWAMNRLRLKEAGVDTKARRYILWCMAKFRQGLDPAQFAHPPKPRKKIRGHGPAVQNGKRIRSKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.39
4 0.43
5 0.42
6 0.47
7 0.49
8 0.51
9 0.47
10 0.46
11 0.53
12 0.46
13 0.44
14 0.36
15 0.3
16 0.25
17 0.22
18 0.22
19 0.15
20 0.15
21 0.12
22 0.14
23 0.16
24 0.14
25 0.15
26 0.14
27 0.16
28 0.15
29 0.15
30 0.15
31 0.13
32 0.14
33 0.13
34 0.14
35 0.14
36 0.16
37 0.21
38 0.2
39 0.21
40 0.2
41 0.2
42 0.19
43 0.19
44 0.17
45 0.13
46 0.14
47 0.13
48 0.12
49 0.12
50 0.14
51 0.13
52 0.14
53 0.14
54 0.13
55 0.14
56 0.15
57 0.14
58 0.15
59 0.17
60 0.2
61 0.2
62 0.24
63 0.23
64 0.27
65 0.29
66 0.26
67 0.24
68 0.21
69 0.26
70 0.3
71 0.38
72 0.35
73 0.38
74 0.4
75 0.44
76 0.42
77 0.37
78 0.34
79 0.28
80 0.31
81 0.28
82 0.28
83 0.26
84 0.29
85 0.3
86 0.26
87 0.32
88 0.36
89 0.42
90 0.48
91 0.56
92 0.63
93 0.69
94 0.78
95 0.8
96 0.83
97 0.85
98 0.83
99 0.81
100 0.79
101 0.78
102 0.77
103 0.7
104 0.66
105 0.58
106 0.6
107 0.6