Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8E5A1

Protein Details
Accession S8E5A1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
180-200RVDGAKQSKRRPVRGLPRNCYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences FDPTLGRPCCTADDFQFDPLSFPRSPWNLSVANVFTRSFLLLYPNHPEQKVHAAWVRHSERLRTRYQELASTENQRAIVREVHRRQERRRNVSSLHLHIGLVGSVSPKAVDILDALGIEGMSSDESDHESGGGAPTYIASGLNWRSPALCAWLRAFDSLHLCMRYREGFKASAGAWPHYRVDGAKQSKRRPVRGLPRNCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.3
5 0.29
6 0.27
7 0.28
8 0.21
9 0.2
10 0.25
11 0.27
12 0.29
13 0.28
14 0.32
15 0.28
16 0.29
17 0.33
18 0.27
19 0.26
20 0.26
21 0.24
22 0.2
23 0.19
24 0.18
25 0.14
26 0.12
27 0.14
28 0.14
29 0.16
30 0.22
31 0.27
32 0.29
33 0.29
34 0.29
35 0.28
36 0.34
37 0.32
38 0.3
39 0.29
40 0.27
41 0.29
42 0.38
43 0.38
44 0.35
45 0.36
46 0.38
47 0.42
48 0.46
49 0.49
50 0.45
51 0.45
52 0.45
53 0.45
54 0.43
55 0.37
56 0.37
57 0.35
58 0.34
59 0.32
60 0.27
61 0.27
62 0.22
63 0.21
64 0.19
65 0.21
66 0.2
67 0.29
68 0.32
69 0.4
70 0.48
71 0.53
72 0.59
73 0.64
74 0.71
75 0.69
76 0.7
77 0.64
78 0.59
79 0.61
80 0.58
81 0.5
82 0.43
83 0.35
84 0.29
85 0.25
86 0.23
87 0.14
88 0.09
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.05
113 0.06
114 0.06
115 0.05
116 0.06
117 0.06
118 0.07
119 0.06
120 0.05
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.04
127 0.08
128 0.1
129 0.12
130 0.12
131 0.13
132 0.13
133 0.14
134 0.15
135 0.17
136 0.17
137 0.17
138 0.18
139 0.21
140 0.22
141 0.22
142 0.22
143 0.18
144 0.2
145 0.21
146 0.23
147 0.22
148 0.22
149 0.21
150 0.25
151 0.28
152 0.27
153 0.28
154 0.28
155 0.28
156 0.28
157 0.3
158 0.26
159 0.25
160 0.25
161 0.25
162 0.24
163 0.25
164 0.26
165 0.23
166 0.24
167 0.21
168 0.25
169 0.32
170 0.39
171 0.45
172 0.53
173 0.6
174 0.69
175 0.77
176 0.78
177 0.76
178 0.77
179 0.79
180 0.81