FuNGI

Q5ADL8

Protein Details

Accession

Q5ADL8

Localization Confidence

High

Confidence Score

18.5

NoLS Segment(s)

Position	Sequence	Protein Nature
60-86	GTTKSGSGLPNKKKRRRSTANIDSEEL	Hydrophilic

NLS Segment(s)

Position	Sequence
70-77	NKKKRRRS
102-105	KRRR

Subcellular Location(s)

nucl 23, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR011598 bHLH_dom IPR036638 HLH_DNA-bd_sf
Gene Ontology	GO:0005634 C:nucleus GO:0046983 F:protein dimerization activity GO:0007155 P:cell adhesion GO:1900189 P:positive regulation of cell adhesion involved in single-species biofilm formation GO:0010811 P:positive regulation of cell-substrate adhesion GO:0006357 P:regulation of transcription by RNA polymerase II GO:0044011 P:single-species biofilm formation on inanimate substrate
KEGG	cal:CAALFM_C306790WA -
Pfam	View protein in Pfam PF00010 HLH
PROSITE	View protein in PROSITE PS50888 BHLH

Amino Acid Sequences

MSLPSPPVLKTTIIQLNKELDPEDDNNNYEILTNDYNNYGSSNTSDAGSIPTSPIIEVSGTTKSGSGLPNKKKRRRSTANIDSEELAKRKNETKQLHSIIEKRRRIKINREFEALKYLIPACRNCNTGSSGGSATPTSSTKKASTNSNNNGNKIDGMYKLTILKSSVEYILYLHHIIQKQHQLLSSISAKDTNGGILAEKLKAFEDFDIDFAKVPLNVNQYRNIDKDFNFKDLMQDLDGRSVNTESPETIIEENEPVSETSSTNNTTTLHYSNSSVLPSRTSSIVSSRQSSSLPTPELTPILSILNKYSTSNNQLNNRKNSNPISPQTVCIKSQNPSPFTMPMKSSLSTSIVNSPSSSSSLSGSKSYMAGNNAVNTVKFSLPDPVVNPNSTLNDNIPRKGLISGIPEEEEEEKINKGSANTETVNSGSASSDENNDNDRGVLLKLTDQDVSKTLLALRKSSIDSLLN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.36
2	0.37
3	0.4
4	0.39
5	0.4
6	0.33
7	0.25
8	0.27
9	0.28
10	0.29
11	0.27
12	0.28
13	0.27
14	0.26
15	0.24
16	0.2
17	0.18
18	0.17
19	0.17
20	0.17
21	0.17
22	0.19
23	0.19
24	0.19
25	0.19
26	0.15
27	0.13
28	0.13
29	0.14
30	0.13
31	0.13
32	0.13
33	0.13
34	0.15
35	0.15
36	0.13
37	0.12
38	0.12
39	0.12
40	0.12
41	0.12
42	0.1
43	0.09
44	0.09
45	0.11
46	0.12
47	0.13
48	0.13
49	0.13
50	0.13
51	0.16
52	0.2
53	0.27
54	0.34
55	0.44
56	0.54
57	0.65
58	0.73
59	0.8
60	0.86
61	0.87
62	0.88
63	0.87
64	0.88
65	0.88
66	0.89
67	0.83
68	0.75
69	0.65
70	0.58
71	0.52
72	0.42
73	0.34
74	0.25
75	0.25
76	0.29
77	0.35
78	0.42
79	0.44
80	0.5
81	0.58
82	0.61
83	0.63
84	0.61
85	0.62
86	0.63
87	0.66
88	0.67
89	0.62
90	0.65
91	0.69
92	0.71
93	0.74
94	0.74
95	0.75
96	0.72
97	0.72
98	0.65
99	0.57
100	0.57
101	0.46
102	0.36
103	0.28
104	0.25
105	0.22
106	0.24
107	0.25
108	0.23
109	0.26
110	0.28
111	0.27
112	0.28
113	0.28
114	0.25
115	0.24
116	0.22
117	0.19
118	0.17
119	0.18
120	0.15
121	0.12
122	0.12
123	0.13
124	0.14
125	0.15
126	0.18
127	0.19
128	0.25
129	0.27
130	0.35
131	0.43
132	0.5
133	0.55
134	0.62
135	0.63
136	0.59
137	0.58
138	0.49
139	0.4
140	0.31
141	0.26
142	0.17
143	0.16
144	0.15
145	0.15
146	0.16
147	0.16
148	0.16
149	0.14
150	0.14
151	0.13
152	0.14
153	0.13
154	0.11
155	0.11
156	0.1
157	0.11
158	0.11
159	0.1
160	0.1
161	0.13
162	0.15
163	0.16
164	0.21
165	0.27
166	0.27
167	0.28
168	0.28
169	0.25
170	0.23
171	0.26
172	0.25
173	0.19
174	0.17
175	0.17
176	0.16
177	0.15
178	0.15
179	0.11
180	0.08
181	0.07
182	0.07
183	0.07
184	0.09
185	0.08
186	0.08
187	0.09
188	0.08
189	0.09
190	0.09
191	0.08
192	0.09
193	0.09
194	0.1
195	0.1
196	0.1
197	0.1
198	0.09
199	0.1
200	0.08
201	0.08
202	0.1
203	0.15
204	0.19
205	0.2
206	0.25
207	0.27
208	0.3
209	0.3
210	0.3
211	0.26
212	0.24
213	0.3
214	0.27
215	0.27
216	0.25
217	0.24
218	0.23
219	0.21
220	0.21
221	0.14
222	0.14
223	0.11
224	0.14
225	0.14
226	0.12
227	0.12
228	0.12
229	0.11
230	0.1
231	0.1
232	0.07
233	0.08
234	0.08
235	0.09
236	0.09
237	0.08
238	0.08
239	0.08
240	0.08
241	0.07
242	0.07
243	0.06
244	0.07
245	0.07
246	0.07
247	0.08
248	0.1
249	0.12
250	0.11
251	0.12
252	0.12
253	0.13
254	0.15
255	0.15
256	0.15
257	0.14
258	0.15
259	0.16
260	0.16
261	0.15
262	0.14
263	0.13
264	0.13
265	0.13
266	0.13
267	0.12
268	0.12
269	0.12
270	0.15
271	0.22
272	0.22
273	0.24
274	0.24
275	0.25
276	0.24
277	0.26
278	0.24
279	0.21
280	0.21
281	0.18
282	0.18
283	0.18
284	0.18
285	0.16
286	0.13
287	0.1
288	0.1
289	0.1
290	0.09
291	0.09
292	0.11
293	0.12
294	0.13
295	0.15
296	0.17
297	0.23
298	0.28
299	0.33
300	0.39
301	0.47
302	0.54
303	0.59
304	0.6
305	0.56
306	0.57
307	0.56
308	0.54
309	0.52
310	0.47
311	0.48
312	0.43
313	0.44
314	0.44
315	0.43
316	0.37
317	0.35
318	0.35
319	0.29
320	0.36
321	0.4
322	0.36
323	0.36
324	0.37
325	0.38
326	0.38
327	0.39
328	0.33
329	0.3
330	0.31
331	0.28
332	0.27
333	0.24
334	0.24
335	0.21
336	0.22
337	0.24
338	0.22
339	0.22
340	0.22
341	0.21
342	0.19
343	0.2
344	0.19
345	0.13
346	0.14
347	0.16
348	0.17
349	0.17
350	0.16
351	0.16
352	0.16
353	0.17
354	0.18
355	0.17
356	0.18
357	0.19
358	0.19
359	0.2
360	0.2
361	0.18
362	0.17
363	0.17
364	0.15
365	0.14
366	0.14
367	0.17
368	0.18
369	0.21
370	0.21
371	0.26
372	0.29
373	0.29
374	0.29
375	0.26
376	0.28
377	0.27
378	0.27
379	0.22
380	0.29
381	0.31
382	0.32
383	0.31
384	0.28
385	0.28
386	0.27
387	0.25
388	0.2
389	0.22
390	0.23
391	0.23
392	0.23
393	0.22
394	0.24
395	0.23
396	0.21
397	0.18
398	0.16
399	0.15
400	0.15
401	0.16
402	0.16
403	0.15
404	0.18
405	0.18
406	0.22
407	0.23
408	0.23
409	0.24
410	0.22
411	0.23
412	0.19
413	0.17
414	0.12
415	0.11
416	0.13
417	0.13
418	0.17
419	0.17
420	0.19
421	0.22
422	0.22
423	0.22
424	0.19
425	0.18
426	0.15
427	0.14
428	0.13
429	0.11
430	0.14
431	0.16
432	0.18
433	0.2
434	0.2
435	0.21
436	0.22
437	0.25
438	0.22
439	0.2
440	0.23
441	0.25
442	0.26
443	0.26
444	0.27
445	0.28
446	0.3
447	0.31

Q5ADL8

3D AlphaFold-predicted Structure Viewer