Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8DVS0

Protein Details
Accession S8DVS0   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-120ADKDGQQRGRKKGRKQVESSDDKABasic
NLS Segment(s)
PositionSequence
102-111QQRGRKKGRK
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MSPSRKMRSRTATRAASASKHANQPSLTSTKPVKGTKCGRSPSDAGPGPMSVEEQNQLNRLMAKKKRYEEQEEAARKANVHGKAAAMVAKEVAEKAADKDGQQRGRKKGRKQVESSDDKASGGRDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.59
3 0.52
4 0.47
5 0.45
6 0.4
7 0.42
8 0.41
9 0.4
10 0.38
11 0.37
12 0.37
13 0.34
14 0.3
15 0.28
16 0.29
17 0.3
18 0.36
19 0.39
20 0.37
21 0.41
22 0.49
23 0.53
24 0.59
25 0.59
26 0.54
27 0.54
28 0.54
29 0.48
30 0.48
31 0.41
32 0.34
33 0.29
34 0.27
35 0.23
36 0.2
37 0.18
38 0.1
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.12
47 0.13
48 0.2
49 0.24
50 0.29
51 0.34
52 0.36
53 0.42
54 0.45
55 0.51
56 0.48
57 0.49
58 0.52
59 0.5
60 0.49
61 0.46
62 0.41
63 0.33
64 0.31
65 0.31
66 0.23
67 0.21
68 0.2
69 0.18
70 0.18
71 0.19
72 0.18
73 0.12
74 0.1
75 0.09
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.07
82 0.08
83 0.13
84 0.14
85 0.14
86 0.22
87 0.3
88 0.38
89 0.45
90 0.51
91 0.56
92 0.66
93 0.74
94 0.76
95 0.78
96 0.8
97 0.82
98 0.81
99 0.82
100 0.81
101 0.8
102 0.75
103 0.7
104 0.6
105 0.51
106 0.45
107 0.36