Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8B8V9

Protein Details
Accession S8B8V9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
3-56EKYGVRKNRSPAKPKLTPTKAPKKRVGKPQETPKVATPKKRTKAKSANDSKCTCHydrophilic
NLS Segment(s)
PositionSequence
8-47RKNRSPAKPKLTPTKAPKKRVGKPQETPKVATPKKRTKAK
Subcellular Location(s) nucl 17.5, mito_nucl 10.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MAEKYGVRKNRSPAKPKLTPTKAPKKRVGKPQETPKVATPKKRTKAKSANDSKCTCEPDEYTHFLGARLVRTNTPAARYTSEQATWLKEMKGEYTIISSGADTFFDDTWRKLLRFYLKEYGNTTGYFEGIIKDCSFVVSKPEDPLVPDKARKIWWKTDTRDSNRRSGDNRYPSLWGRGSLTVTKDFKVTCVLFDFVGPRFEIKGEKMDEKAMKDYDDYLTATEWM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.82
5 0.79
6 0.79
7 0.81
8 0.82
9 0.82
10 0.82
11 0.84
12 0.83
13 0.84
14 0.85
15 0.85
16 0.84
17 0.84
18 0.87
19 0.87
20 0.81
21 0.76
22 0.72
23 0.73
24 0.68
25 0.68
26 0.67
27 0.67
28 0.73
29 0.79
30 0.76
31 0.76
32 0.81
33 0.81
34 0.82
35 0.82
36 0.82
37 0.8
38 0.78
39 0.72
40 0.66
41 0.61
42 0.51
43 0.43
44 0.35
45 0.34
46 0.37
47 0.36
48 0.33
49 0.31
50 0.3
51 0.26
52 0.27
53 0.22
54 0.19
55 0.19
56 0.18
57 0.17
58 0.19
59 0.23
60 0.22
61 0.23
62 0.23
63 0.22
64 0.23
65 0.25
66 0.25
67 0.24
68 0.23
69 0.22
70 0.21
71 0.21
72 0.2
73 0.19
74 0.17
75 0.16
76 0.16
77 0.15
78 0.15
79 0.13
80 0.11
81 0.11
82 0.11
83 0.09
84 0.09
85 0.08
86 0.07
87 0.06
88 0.06
89 0.05
90 0.06
91 0.06
92 0.08
93 0.09
94 0.08
95 0.12
96 0.14
97 0.14
98 0.13
99 0.17
100 0.23
101 0.25
102 0.29
103 0.33
104 0.32
105 0.34
106 0.36
107 0.35
108 0.28
109 0.25
110 0.22
111 0.15
112 0.13
113 0.12
114 0.1
115 0.08
116 0.08
117 0.09
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.08
124 0.11
125 0.13
126 0.14
127 0.15
128 0.16
129 0.15
130 0.16
131 0.2
132 0.22
133 0.23
134 0.24
135 0.25
136 0.27
137 0.32
138 0.38
139 0.4
140 0.42
141 0.47
142 0.54
143 0.57
144 0.64
145 0.69
146 0.7
147 0.74
148 0.68
149 0.68
150 0.64
151 0.63
152 0.56
153 0.55
154 0.56
155 0.55
156 0.55
157 0.48
158 0.48
159 0.45
160 0.48
161 0.41
162 0.32
163 0.27
164 0.26
165 0.27
166 0.27
167 0.28
168 0.29
169 0.3
170 0.29
171 0.28
172 0.26
173 0.24
174 0.28
175 0.25
176 0.2
177 0.22
178 0.22
179 0.2
180 0.21
181 0.22
182 0.17
183 0.18
184 0.17
185 0.14
186 0.14
187 0.16
188 0.18
189 0.18
190 0.23
191 0.26
192 0.29
193 0.3
194 0.36
195 0.39
196 0.39
197 0.42
198 0.37
199 0.33
200 0.31
201 0.32
202 0.27
203 0.26
204 0.23
205 0.18