Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8A5L1

Protein Details
Accession S8A5L1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
172-195SSPSRTPKPLGKDKKRVVKGRIGKBasic
NLS Segment(s)
PositionSequence
177-201TPKPLGKDKKRVVKGRIGKIGKVKR
Subcellular Location(s) cyto_nucl 14.833, nucl 13, cyto 12.5, cyto_mito 7.332
Family & Domain DBs
Amino Acid Sequences MSADSSINNDPFALPSLILTKLSVPATHYVSEPSDAIVINLTLNPKVVITCSTISGHELGYFGWKSGAVDIGFENDSEVVISYSTTPTIWSHGQRVPETKEFLSERGWFHTFANVVTRGSSDGSGIMKLSVKSLLDHHERGSQDIDTATITPPEMREEDYDDDRGESLSGLSSPSRTPKPLGKDKKRVVKGRIGKIGKVKRASVDGTEAMKKLLTPLEKLKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.16
5 0.16
6 0.15
7 0.13
8 0.16
9 0.17
10 0.16
11 0.16
12 0.19
13 0.22
14 0.22
15 0.22
16 0.2
17 0.21
18 0.21
19 0.19
20 0.16
21 0.14
22 0.13
23 0.12
24 0.1
25 0.09
26 0.08
27 0.09
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.1
36 0.12
37 0.12
38 0.14
39 0.15
40 0.15
41 0.16
42 0.16
43 0.14
44 0.11
45 0.11
46 0.09
47 0.12
48 0.12
49 0.11
50 0.1
51 0.1
52 0.1
53 0.1
54 0.13
55 0.09
56 0.09
57 0.09
58 0.11
59 0.11
60 0.11
61 0.1
62 0.07
63 0.07
64 0.06
65 0.06
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.1
76 0.13
77 0.14
78 0.18
79 0.2
80 0.24
81 0.24
82 0.28
83 0.29
84 0.29
85 0.3
86 0.26
87 0.28
88 0.25
89 0.25
90 0.24
91 0.22
92 0.2
93 0.21
94 0.22
95 0.19
96 0.18
97 0.19
98 0.17
99 0.14
100 0.16
101 0.13
102 0.12
103 0.11
104 0.11
105 0.1
106 0.1
107 0.1
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.09
117 0.08
118 0.08
119 0.09
120 0.11
121 0.16
122 0.18
123 0.19
124 0.2
125 0.24
126 0.24
127 0.25
128 0.25
129 0.19
130 0.16
131 0.15
132 0.14
133 0.09
134 0.1
135 0.09
136 0.07
137 0.08
138 0.07
139 0.08
140 0.1
141 0.1
142 0.11
143 0.12
144 0.16
145 0.2
146 0.22
147 0.23
148 0.21
149 0.2
150 0.19
151 0.18
152 0.13
153 0.09
154 0.07
155 0.06
156 0.06
157 0.07
158 0.07
159 0.08
160 0.1
161 0.16
162 0.19
163 0.2
164 0.24
165 0.3
166 0.39
167 0.48
168 0.58
169 0.62
170 0.7
171 0.77
172 0.84
173 0.86
174 0.86
175 0.81
176 0.8
177 0.79
178 0.78
179 0.79
180 0.72
181 0.68
182 0.69
183 0.72
184 0.7
185 0.65
186 0.58
187 0.51
188 0.53
189 0.5
190 0.43
191 0.4
192 0.36
193 0.35
194 0.36
195 0.33
196 0.29
197 0.26
198 0.23
199 0.21
200 0.23
201 0.21
202 0.23