Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8APY6

Protein Details
Accession S8APY6   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-103LREEHNPKKKQEKEKKATHTEEPBasic
NLS Segment(s)
PositionSequence
87-96PKKKQEKEKK
Subcellular Location(s) nucl 19, cyto 7.5, cyto_mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR008676  MRG  
IPR038217  MRG_C_sf  
IPR026541  MRG_dom  
IPR025995  Tudor-knot  
Gene Ontology GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05712  MRG  
PF11717  Tudor-knot  
PROSITE View protein in PROSITE  
PS51640  MRG  
CDD cd18983  CBD_MSL3_like  
Amino Acid Sequences MPPKAAKPAPPLYEVGERVLCFHGPLLYEAKVLEIKNPGEPGASYSYKVHYKGWKSSWDEWVPQDRVLGWTDENLQKQKELREEHNPKKKQEKEKKATHTEEPIVPTVRGQKRAREMDMDKEEDFIKRHEIKINVPEIVKSLLVDDWENVTKNGTLVKLPREITVNQFLTDFFDSTQHKYSGAQREVYEEILSGLRSYFDKCLGTMLLYRFERDQYNEIKKQHPDTDICDLYGTEHLLRLFVTMPELIAHTNMDSQAVNSLREHLDEIMMFISRNHEKYILSEYEQPPPSYNATSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.34
4 0.31
5 0.3
6 0.31
7 0.26
8 0.19
9 0.19
10 0.17
11 0.14
12 0.17
13 0.18
14 0.17
15 0.17
16 0.16
17 0.18
18 0.2
19 0.19
20 0.2
21 0.21
22 0.22
23 0.25
24 0.26
25 0.24
26 0.21
27 0.21
28 0.21
29 0.22
30 0.22
31 0.21
32 0.21
33 0.26
34 0.29
35 0.31
36 0.33
37 0.34
38 0.39
39 0.46
40 0.49
41 0.53
42 0.56
43 0.59
44 0.63
45 0.58
46 0.56
47 0.52
48 0.56
49 0.49
50 0.42
51 0.38
52 0.29
53 0.27
54 0.25
55 0.22
56 0.14
57 0.13
58 0.18
59 0.21
60 0.25
61 0.26
62 0.25
63 0.27
64 0.29
65 0.33
66 0.35
67 0.36
68 0.37
69 0.45
70 0.54
71 0.61
72 0.69
73 0.69
74 0.67
75 0.73
76 0.77
77 0.77
78 0.78
79 0.79
80 0.78
81 0.83
82 0.87
83 0.85
84 0.81
85 0.74
86 0.69
87 0.61
88 0.54
89 0.47
90 0.4
91 0.33
92 0.28
93 0.25
94 0.28
95 0.29
96 0.35
97 0.34
98 0.37
99 0.44
100 0.49
101 0.49
102 0.46
103 0.44
104 0.44
105 0.47
106 0.44
107 0.35
108 0.32
109 0.31
110 0.26
111 0.25
112 0.17
113 0.19
114 0.19
115 0.2
116 0.24
117 0.25
118 0.27
119 0.32
120 0.33
121 0.28
122 0.26
123 0.24
124 0.21
125 0.2
126 0.16
127 0.1
128 0.09
129 0.07
130 0.08
131 0.08
132 0.07
133 0.08
134 0.09
135 0.09
136 0.09
137 0.09
138 0.08
139 0.08
140 0.1
141 0.08
142 0.09
143 0.1
144 0.13
145 0.17
146 0.18
147 0.18
148 0.2
149 0.2
150 0.22
151 0.28
152 0.26
153 0.22
154 0.21
155 0.2
156 0.2
157 0.2
158 0.17
159 0.1
160 0.13
161 0.15
162 0.17
163 0.21
164 0.18
165 0.17
166 0.19
167 0.26
168 0.31
169 0.32
170 0.32
171 0.29
172 0.32
173 0.32
174 0.31
175 0.24
176 0.15
177 0.13
178 0.11
179 0.11
180 0.08
181 0.06
182 0.07
183 0.07
184 0.09
185 0.09
186 0.11
187 0.12
188 0.12
189 0.13
190 0.13
191 0.13
192 0.16
193 0.16
194 0.2
195 0.2
196 0.21
197 0.2
198 0.22
199 0.24
200 0.23
201 0.27
202 0.28
203 0.37
204 0.42
205 0.44
206 0.48
207 0.5
208 0.52
209 0.52
210 0.49
211 0.43
212 0.42
213 0.47
214 0.42
215 0.38
216 0.33
217 0.27
218 0.24
219 0.23
220 0.19
221 0.11
222 0.12
223 0.12
224 0.12
225 0.12
226 0.11
227 0.11
228 0.09
229 0.11
230 0.09
231 0.09
232 0.09
233 0.1
234 0.09
235 0.09
236 0.09
237 0.08
238 0.1
239 0.1
240 0.1
241 0.1
242 0.1
243 0.15
244 0.16
245 0.17
246 0.16
247 0.2
248 0.19
249 0.2
250 0.21
251 0.16
252 0.16
253 0.15
254 0.16
255 0.13
256 0.12
257 0.11
258 0.1
259 0.16
260 0.19
261 0.21
262 0.22
263 0.23
264 0.23
265 0.26
266 0.33
267 0.3
268 0.29
269 0.37
270 0.37
271 0.44
272 0.47
273 0.45
274 0.41
275 0.4
276 0.41