Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7ZXD5

Protein Details
Accession S7ZXD5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-62QLQQHKQPQSQRKRQHSNYTPSAKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MQFKPTQRKNGAIVLAMHKHLGPPPMLPTSSTAQEEDQLQQHKQPQSQRKRQHSNYTPSAKSSGSKSSRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.32
4 0.29
5 0.22
6 0.21
7 0.2
8 0.19
9 0.14
10 0.13
11 0.16
12 0.18
13 0.18
14 0.17
15 0.18
16 0.18
17 0.2
18 0.2
19 0.17
20 0.15
21 0.16
22 0.16
23 0.14
24 0.16
25 0.16
26 0.15
27 0.17
28 0.23
29 0.25
30 0.28
31 0.36
32 0.42
33 0.51
34 0.61
35 0.68
36 0.73
37 0.8
38 0.83
39 0.86
40 0.85
41 0.83
42 0.82
43 0.8
44 0.71
45 0.63
46 0.59
47 0.49
48 0.42
49 0.38
50 0.38
51 0.38