Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BV00

Protein Details
Accession S8BV00    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
203-242GDEPLDKKKGGKKKPEKKAEKKPEKKVEKKAEKKKEDGGDBasic
NLS Segment(s)
PositionSequence
209-257KKKGGKKKPEKKAEKKPEKKVEKKAEKKKEDGGDPEKPKKKANLFTRIK
Subcellular Location(s) cyto 11.5, cyto_nucl 11.333, nucl 10, mito_nucl 6.333, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010989  SNARE  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
Amino Acid Sequences MSTGAEETTPALAPEGASSSTLDYPKIIADIDERSTSMGTIYQETLPKIEESEIEELYNQVEPLATQVASIIEPVIKHFKELKEKEDSNPDQIKEAKPLAADIDAALQRYKAALGDFSKTTGETLGKHYKTMNPHASPEEIQDIQEGDEPWFFSNPGFEQRSDEWHAARKDYIVRYKELKKVEQRTKETKPWFEAVTAVKTYGDEPLDKKKGGKKKPEKKAEKKPEKKVEKKAEKKKEDGGDPEKPKKKANLFTRIKMLVSGKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.11
5 0.11
6 0.13
7 0.17
8 0.18
9 0.17
10 0.15
11 0.15
12 0.15
13 0.15
14 0.12
15 0.09
16 0.11
17 0.14
18 0.17
19 0.17
20 0.17
21 0.17
22 0.17
23 0.16
24 0.14
25 0.13
26 0.12
27 0.13
28 0.15
29 0.17
30 0.19
31 0.2
32 0.2
33 0.18
34 0.17
35 0.16
36 0.15
37 0.13
38 0.15
39 0.17
40 0.17
41 0.16
42 0.15
43 0.14
44 0.15
45 0.14
46 0.1
47 0.07
48 0.06
49 0.06
50 0.07
51 0.09
52 0.08
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.07
59 0.06
60 0.06
61 0.09
62 0.15
63 0.14
64 0.17
65 0.22
66 0.26
67 0.36
68 0.39
69 0.41
70 0.43
71 0.45
72 0.46
73 0.51
74 0.48
75 0.46
76 0.48
77 0.43
78 0.38
79 0.39
80 0.38
81 0.32
82 0.31
83 0.24
84 0.19
85 0.19
86 0.16
87 0.14
88 0.12
89 0.08
90 0.1
91 0.1
92 0.1
93 0.1
94 0.09
95 0.08
96 0.08
97 0.08
98 0.06
99 0.05
100 0.08
101 0.09
102 0.12
103 0.12
104 0.13
105 0.13
106 0.12
107 0.12
108 0.1
109 0.1
110 0.09
111 0.15
112 0.22
113 0.22
114 0.23
115 0.24
116 0.26
117 0.3
118 0.36
119 0.37
120 0.3
121 0.31
122 0.32
123 0.33
124 0.3
125 0.27
126 0.23
127 0.15
128 0.14
129 0.13
130 0.11
131 0.1
132 0.12
133 0.11
134 0.08
135 0.09
136 0.09
137 0.09
138 0.09
139 0.09
140 0.07
141 0.08
142 0.09
143 0.14
144 0.15
145 0.15
146 0.19
147 0.19
148 0.25
149 0.27
150 0.27
151 0.22
152 0.27
153 0.28
154 0.26
155 0.25
156 0.22
157 0.23
158 0.27
159 0.34
160 0.29
161 0.31
162 0.36
163 0.42
164 0.46
165 0.45
166 0.47
167 0.49
168 0.57
169 0.63
170 0.66
171 0.68
172 0.7
173 0.73
174 0.74
175 0.72
176 0.67
177 0.62
178 0.56
179 0.49
180 0.41
181 0.38
182 0.32
183 0.3
184 0.25
185 0.21
186 0.18
187 0.18
188 0.18
189 0.17
190 0.15
191 0.13
192 0.16
193 0.25
194 0.29
195 0.3
196 0.34
197 0.39
198 0.47
199 0.54
200 0.63
201 0.65
202 0.71
203 0.81
204 0.87
205 0.9
206 0.91
207 0.94
208 0.94
209 0.94
210 0.93
211 0.94
212 0.93
213 0.93
214 0.92
215 0.92
216 0.92
217 0.91
218 0.92
219 0.92
220 0.92
221 0.89
222 0.84
223 0.82
224 0.79
225 0.74
226 0.73
227 0.69
228 0.68
229 0.7
230 0.75
231 0.74
232 0.69
233 0.68
234 0.69
235 0.71
236 0.7
237 0.71
238 0.72
239 0.72
240 0.75
241 0.78
242 0.71
243 0.62
244 0.57
245 0.5
246 0.47