Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RRW3

Protein Details
Accession F4RRW3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-57EIGIKPYKAKKQKLKSDLNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042530  EME1/EME2_C  
KEGG mlr:MELLADRAFT_72281  -  
Amino Acid Sequences MDEISRQIEMIKILTKCHVLKVEDCNSLSNWLWELSYEIGIKPYKAKKQKLKSDLNLEIEGNKGKDLEDTFLKMLKCLPRVGEAESKAIAQRFPTINHLFSAWDSLVGRNDLVGAEDMLVGCKKGNSNKAIGKITSKKIFDVFYSSKDGDTCINNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.26
4 0.31
5 0.34
6 0.3
7 0.34
8 0.41
9 0.45
10 0.44
11 0.44
12 0.4
13 0.36
14 0.37
15 0.33
16 0.25
17 0.2
18 0.15
19 0.14
20 0.12
21 0.13
22 0.11
23 0.12
24 0.12
25 0.11
26 0.14
27 0.15
28 0.15
29 0.2
30 0.25
31 0.33
32 0.41
33 0.5
34 0.57
35 0.67
36 0.76
37 0.79
38 0.82
39 0.79
40 0.79
41 0.76
42 0.69
43 0.6
44 0.5
45 0.41
46 0.33
47 0.28
48 0.19
49 0.13
50 0.1
51 0.08
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.13
58 0.16
59 0.15
60 0.14
61 0.16
62 0.17
63 0.18
64 0.17
65 0.17
66 0.18
67 0.19
68 0.22
69 0.24
70 0.21
71 0.21
72 0.21
73 0.2
74 0.18
75 0.17
76 0.14
77 0.1
78 0.13
79 0.13
80 0.14
81 0.21
82 0.22
83 0.23
84 0.23
85 0.22
86 0.18
87 0.17
88 0.19
89 0.12
90 0.11
91 0.11
92 0.11
93 0.12
94 0.12
95 0.12
96 0.09
97 0.09
98 0.08
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.06
109 0.08
110 0.11
111 0.17
112 0.24
113 0.26
114 0.34
115 0.39
116 0.45
117 0.48
118 0.46
119 0.48
120 0.49
121 0.54
122 0.54
123 0.5
124 0.46
125 0.45
126 0.45
127 0.38
128 0.39
129 0.34
130 0.3
131 0.36
132 0.34
133 0.32
134 0.3
135 0.3
136 0.25