Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AN86

Protein Details
Accession S8AN86   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-87SESFGLDRREPRRQRKAGRRGRKNRGRSFGDABasic
NLS Segment(s)
PositionSequence
63-83RREPRRQRKAGRRGRKNRGRS
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKFSTLLIAPLLVAASSASVFSGSELDVRDESSYGVEARDLGALDQASGEMGAYSSESFGLDRREPRRQRKAGRRGRKNRGRSFGDAPVFRRHAPVTAPADSKAGVPATGGAPATGGAPATGGAPATGGVPANGAPANPGATKQGTPPAGSPGAGTAPATNNTPATTGAGASGDKSKVAPGLTPATPDTKAATPDTKAATPNTKAATPNTNTTTPDTKAATGAGLAPGQLKKILIQAATTLKASPDFIKVLTAASDADLDKMAAAPAGGTAPATSKTGTSATPGAADTKTPPAADTKTPPAAKGGNPAPGLQPAAGATTGTPPATPPTAGTPPAGGAKTGGPAPGLQPATPPAAGGKTTTGTAAPGGEAPAPAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.07
10 0.07
11 0.09
12 0.11
13 0.13
14 0.14
15 0.15
16 0.15
17 0.14
18 0.14
19 0.13
20 0.13
21 0.11
22 0.11
23 0.1
24 0.09
25 0.1
26 0.11
27 0.1
28 0.09
29 0.11
30 0.1
31 0.1
32 0.1
33 0.09
34 0.07
35 0.07
36 0.07
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.09
47 0.14
48 0.18
49 0.26
50 0.32
51 0.42
52 0.52
53 0.62
54 0.71
55 0.75
56 0.81
57 0.85
58 0.9
59 0.9
60 0.92
61 0.93
62 0.92
63 0.94
64 0.93
65 0.93
66 0.91
67 0.89
68 0.85
69 0.79
70 0.74
71 0.71
72 0.68
73 0.6
74 0.54
75 0.53
76 0.49
77 0.44
78 0.41
79 0.34
80 0.29
81 0.28
82 0.32
83 0.29
84 0.31
85 0.32
86 0.3
87 0.3
88 0.28
89 0.26
90 0.2
91 0.15
92 0.1
93 0.09
94 0.09
95 0.09
96 0.1
97 0.09
98 0.07
99 0.07
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.08
125 0.08
126 0.08
127 0.09
128 0.11
129 0.12
130 0.12
131 0.18
132 0.17
133 0.18
134 0.18
135 0.2
136 0.19
137 0.18
138 0.17
139 0.12
140 0.12
141 0.11
142 0.1
143 0.07
144 0.08
145 0.09
146 0.1
147 0.09
148 0.09
149 0.09
150 0.1
151 0.09
152 0.09
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08
164 0.09
165 0.09
166 0.08
167 0.09
168 0.13
169 0.13
170 0.14
171 0.14
172 0.15
173 0.15
174 0.15
175 0.15
176 0.12
177 0.14
178 0.14
179 0.15
180 0.14
181 0.16
182 0.18
183 0.17
184 0.17
185 0.17
186 0.2
187 0.2
188 0.22
189 0.21
190 0.21
191 0.21
192 0.22
193 0.26
194 0.24
195 0.27
196 0.27
197 0.27
198 0.26
199 0.29
200 0.3
201 0.25
202 0.26
203 0.23
204 0.19
205 0.18
206 0.17
207 0.14
208 0.1
209 0.1
210 0.07
211 0.06
212 0.06
213 0.08
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.11
220 0.12
221 0.11
222 0.11
223 0.14
224 0.16
225 0.17
226 0.16
227 0.14
228 0.12
229 0.13
230 0.14
231 0.12
232 0.12
233 0.12
234 0.11
235 0.12
236 0.12
237 0.12
238 0.11
239 0.1
240 0.07
241 0.07
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.07
248 0.07
249 0.06
250 0.05
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.07
260 0.08
261 0.08
262 0.08
263 0.1
264 0.11
265 0.11
266 0.13
267 0.13
268 0.13
269 0.14
270 0.14
271 0.15
272 0.13
273 0.14
274 0.14
275 0.17
276 0.18
277 0.17
278 0.17
279 0.19
280 0.22
281 0.26
282 0.28
283 0.3
284 0.37
285 0.37
286 0.37
287 0.37
288 0.37
289 0.34
290 0.37
291 0.34
292 0.32
293 0.33
294 0.34
295 0.31
296 0.3
297 0.3
298 0.22
299 0.19
300 0.12
301 0.13
302 0.12
303 0.1
304 0.09
305 0.1
306 0.12
307 0.11
308 0.11
309 0.1
310 0.14
311 0.16
312 0.16
313 0.14
314 0.19
315 0.23
316 0.25
317 0.25
318 0.22
319 0.22
320 0.27
321 0.25
322 0.19
323 0.16
324 0.16
325 0.17
326 0.17
327 0.16
328 0.12
329 0.12
330 0.14
331 0.2
332 0.2
333 0.18
334 0.19
335 0.21
336 0.24
337 0.23
338 0.22
339 0.17
340 0.18
341 0.19
342 0.18
343 0.19
344 0.16
345 0.17
346 0.17
347 0.15
348 0.14
349 0.14
350 0.13
351 0.11
352 0.11
353 0.12
354 0.12