Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AN86

Protein Details
Accession S8AN86    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-87SESFGLDRREPRRQRKAGRRGRKNRGRSFGDABasic
NLS Segment(s)
PositionSequence
63-83RREPRRQRKAGRRGRKNRGRS
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKFSTLLIAPLLVAASSASVFSGSELDVRDESSYGVEARDLGALDQASGEMGAYSSESFGLDRREPRRQRKAGRRGRKNRGRSFGDAPVFRRHAPVTAPADSKAGVPATGGAPATGGAPATGGAPATGGVPANGAPANPGATKQGTPPAGSPGAGTAPATNNTPATTGAGASGDKSKVAPGLTPATPDTKAATPDTKAATPNTKAATPNTNTTTPDTKAATGAGLAPGQLKKILIQAATTLKASPDFIKVLTAASDADLDKMAAAPAGGTAPATSKTGTSATPGAADTKTPPAADTKTPPAAKGGNPAPGLQPAAGATTGTPPATPPTAGTPPAGGAKTGGPAPGLQPATPPAAGGKTTTGTAAPGGEAPAPAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.07
10 0.07
11 0.09
12 0.11
13 0.13
14 0.14
15 0.15
16 0.15
17 0.14
18 0.14
19 0.13
20 0.13
21 0.11
22 0.11
23 0.1
24 0.09
25 0.1
26 0.11
27 0.1
28 0.09
29 0.11
30 0.1
31 0.1
32 0.1
33 0.09
34 0.07
35 0.07
36 0.07
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.09
47 0.14
48 0.18
49 0.26
50 0.32
51 0.42
52 0.52
53 0.62
54 0.71
55 0.75
56 0.81
57 0.85
58 0.9
59 0.9
60 0.92
61 0.93
62 0.92
63 0.94
64 0.93
65 0.93
66 0.91
67 0.89
68 0.85
69 0.79
70 0.74
71 0.71
72 0.68
73 0.6
74 0.54
75 0.53
76 0.49
77 0.44
78 0.41
79 0.34
80 0.29
81 0.28
82 0.32
83 0.29
84 0.31
85 0.32
86 0.3
87 0.3
88 0.28
89 0.26
90 0.2
91 0.15
92 0.1
93 0.09
94 0.09
95 0.09
96 0.1
97 0.09
98 0.07
99 0.07
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.08
125 0.08
126 0.08
127 0.09
128 0.11
129 0.12
130 0.12
131 0.18
132 0.17
133 0.18
134 0.18
135 0.2
136 0.19
137 0.18
138 0.17
139 0.12
140 0.12
141 0.11
142 0.1
143 0.07
144 0.08
145 0.09
146 0.1
147 0.09
148 0.09
149 0.09
150 0.1
151 0.09
152 0.09
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08
164 0.09
165 0.09
166 0.08
167 0.09
168 0.13
169 0.13
170 0.14
171 0.14
172 0.15
173 0.15
174 0.15
175 0.15
176 0.12
177 0.14
178 0.14
179 0.15
180 0.14
181 0.16
182 0.18
183 0.17
184 0.17
185 0.17
186 0.2
187 0.2
188 0.22
189 0.21
190 0.21
191 0.21
192 0.22
193 0.26
194 0.24
195 0.27
196 0.27
197 0.27
198 0.26
199 0.29
200 0.3
201 0.25
202 0.26
203 0.23
204 0.19
205 0.18
206 0.17
207 0.14
208 0.1
209 0.1
210 0.07
211 0.06
212 0.06
213 0.08
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.11
220 0.12
221 0.11
222 0.11
223 0.14
224 0.16
225 0.17
226 0.16
227 0.14
228 0.12
229 0.13
230 0.14
231 0.12
232 0.12
233 0.12
234 0.11
235 0.12
236 0.12
237 0.12
238 0.11
239 0.1
240 0.07
241 0.07
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.07
248 0.07
249 0.06
250 0.05
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.07
260 0.08
261 0.08
262 0.08
263 0.1
264 0.11
265 0.11
266 0.13
267 0.13
268 0.13
269 0.14
270 0.14
271 0.15
272 0.13
273 0.14
274 0.14
275 0.17
276 0.18
277 0.17
278 0.17
279 0.19
280 0.22
281 0.26
282 0.28
283 0.3
284 0.37
285 0.37
286 0.37
287 0.37
288 0.37
289 0.34
290 0.37
291 0.34
292 0.32
293 0.33
294 0.34
295 0.31
296 0.3
297 0.3
298 0.22
299 0.19
300 0.12
301 0.13
302 0.12
303 0.1
304 0.09
305 0.1
306 0.12
307 0.11
308 0.11
309 0.1
310 0.14
311 0.16
312 0.16
313 0.14
314 0.19
315 0.23
316 0.25
317 0.25
318 0.22
319 0.22
320 0.27
321 0.25
322 0.19
323 0.16
324 0.16
325 0.17
326 0.17
327 0.16
328 0.12
329 0.12
330 0.14
331 0.2
332 0.2
333 0.18
334 0.19
335 0.21
336 0.24
337 0.23
338 0.22
339 0.17
340 0.18
341 0.19
342 0.18
343 0.19
344 0.16
345 0.17
346 0.17
347 0.15
348 0.14
349 0.14
350 0.13
351 0.11
352 0.11
353 0.12
354 0.12