Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8C062

Protein Details
Accession S8C062    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-33LKNEGREPERPAKRRRLSRDCPQYTGHydrophilic
NLS Segment(s)
PositionSequence
17-23RPAKRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSTFQGSLKNEGREPERPAKRRRLSRDCPQYTGHPINKPGIAGTTTTTKMPVALSPKLPHSTTPTATAATIKWDAGGDVVMGELPDPTSSASDTTISYQEYSESEPLAPAEETTPAPAAETSKTLPQPTTHQHHSQLTSTHTTRQSTAKSREERAKSGHQRVHGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.55
4 0.6
5 0.66
6 0.73
7 0.77
8 0.82
9 0.84
10 0.85
11 0.83
12 0.86
13 0.88
14 0.82
15 0.76
16 0.7
17 0.64
18 0.62
19 0.63
20 0.57
21 0.51
22 0.49
23 0.48
24 0.45
25 0.4
26 0.32
27 0.25
28 0.2
29 0.15
30 0.14
31 0.15
32 0.15
33 0.15
34 0.16
35 0.13
36 0.13
37 0.13
38 0.15
39 0.15
40 0.17
41 0.21
42 0.22
43 0.25
44 0.27
45 0.27
46 0.25
47 0.28
48 0.29
49 0.27
50 0.29
51 0.27
52 0.24
53 0.24
54 0.24
55 0.16
56 0.15
57 0.15
58 0.1
59 0.1
60 0.09
61 0.09
62 0.08
63 0.08
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.09
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.11
89 0.1
90 0.1
91 0.09
92 0.09
93 0.09
94 0.1
95 0.09
96 0.07
97 0.07
98 0.08
99 0.08
100 0.09
101 0.1
102 0.08
103 0.09
104 0.09
105 0.1
106 0.09
107 0.11
108 0.12
109 0.16
110 0.19
111 0.19
112 0.2
113 0.21
114 0.26
115 0.32
116 0.38
117 0.39
118 0.42
119 0.46
120 0.5
121 0.51
122 0.48
123 0.43
124 0.4
125 0.41
126 0.38
127 0.4
128 0.38
129 0.37
130 0.37
131 0.4
132 0.43
133 0.46
134 0.52
135 0.55
136 0.56
137 0.62
138 0.69
139 0.69
140 0.66
141 0.64
142 0.67
143 0.67
144 0.71
145 0.69