Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8A5N0

Protein Details
Accession S8A5N0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
108-134FLARLRSKTGRNILKRRKETGRKHLTHBasic
NLS Segment(s)
PositionSequence
91-93RRK
96-131NPSHLVRKRRFGFLARLRSKTGRNILKRRKETGRKH
Subcellular Location(s) nucl 11.5, mito 10.5, cyto_nucl 7.833, cyto_mito 7.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MAFLRRPALVYLRYSTSATYTPFLTSTSRRTFTSLLRPATLSSTTAAPFARPTLPSVTAFATPLLQSSAPITPCSSSSSSLLSLTQARGHRRKTYNPSHLVRKRRFGFLARLRSKTGRNILKRRKETGRKHLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.25
5 0.23
6 0.21
7 0.19
8 0.17
9 0.17
10 0.18
11 0.19
12 0.19
13 0.25
14 0.3
15 0.32
16 0.32
17 0.35
18 0.36
19 0.37
20 0.44
21 0.44
22 0.39
23 0.38
24 0.38
25 0.35
26 0.35
27 0.31
28 0.21
29 0.15
30 0.14
31 0.13
32 0.14
33 0.13
34 0.11
35 0.1
36 0.11
37 0.12
38 0.11
39 0.13
40 0.15
41 0.17
42 0.17
43 0.18
44 0.17
45 0.16
46 0.16
47 0.14
48 0.11
49 0.09
50 0.09
51 0.08
52 0.06
53 0.06
54 0.07
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.1
61 0.14
62 0.13
63 0.13
64 0.13
65 0.14
66 0.15
67 0.15
68 0.14
69 0.12
70 0.12
71 0.12
72 0.16
73 0.18
74 0.25
75 0.3
76 0.34
77 0.42
78 0.45
79 0.54
80 0.58
81 0.65
82 0.67
83 0.69
84 0.71
85 0.73
86 0.75
87 0.77
88 0.74
89 0.73
90 0.67
91 0.65
92 0.63
93 0.57
94 0.6
95 0.59
96 0.64
97 0.6
98 0.6
99 0.58
100 0.59
101 0.59
102 0.56
103 0.57
104 0.56
105 0.6
106 0.68
107 0.74
108 0.81
109 0.83
110 0.83
111 0.84
112 0.85
113 0.85
114 0.85