Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SB09

Protein Details
Accession F4SB09    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-42ATRSKSTRSKSKSASKSKPGNAGKSKTNTKKPRRLQCAATHydrophilic
NLS Segment(s)
PositionSequence
7-36KSTRSKSKSASKSKPGNAGKSKTNTKKPRR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_69515  -  
Amino Acid Sequences MPATRSKSTRSKSKSASKSKPGNAGKSKTNTKKPRRLQCAATPDEQAVDSSDEPKVEDDHKKEEHHAMLPTLANYANVDIEWTDTYADKLLARRKTGSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.82
5 0.84
6 0.8
7 0.81
8 0.76
9 0.76
10 0.73
11 0.68
12 0.65
13 0.63
14 0.67
15 0.66
16 0.71
17 0.71
18 0.74
19 0.8
20 0.82
21 0.86
22 0.84
23 0.81
24 0.76
25 0.74
26 0.72
27 0.65
28 0.57
29 0.47
30 0.38
31 0.34
32 0.28
33 0.19
34 0.12
35 0.1
36 0.08
37 0.09
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.12
44 0.17
45 0.19
46 0.24
47 0.27
48 0.28
49 0.3
50 0.33
51 0.32
52 0.29
53 0.28
54 0.23
55 0.21
56 0.21
57 0.18
58 0.15
59 0.13
60 0.11
61 0.1
62 0.1
63 0.08
64 0.07
65 0.07
66 0.06
67 0.08
68 0.08
69 0.08
70 0.09
71 0.09
72 0.1
73 0.1
74 0.12
75 0.12
76 0.17
77 0.25
78 0.3
79 0.34
80 0.37