Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8A9Q5

Protein Details
Accession S8A9Q5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-33NKNNPNRPRASKAKARPKTKPSHALRRISKTHydrophilic
NLS Segment(s)
PositionSequence
8-32NRPRASKAKARPKTKPSHALRRISK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MANKNNPNRPRASKAKARPKTKPSHALRRISKTNATANHSLSSKKSKKLLRNQAYDAQRIIEEVGKEGGDIMMKDESLSRKKEKLLRNLQLNKEIKEEKESTMDVEPALDVAEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.81
4 0.82
5 0.83
6 0.83
7 0.85
8 0.84
9 0.84
10 0.81
11 0.83
12 0.83
13 0.83
14 0.81
15 0.79
16 0.76
17 0.7
18 0.66
19 0.59
20 0.57
21 0.52
22 0.5
23 0.44
24 0.4
25 0.38
26 0.35
27 0.32
28 0.28
29 0.33
30 0.32
31 0.33
32 0.39
33 0.43
34 0.51
35 0.6
36 0.68
37 0.67
38 0.68
39 0.68
40 0.68
41 0.64
42 0.56
43 0.46
44 0.35
45 0.26
46 0.21
47 0.17
48 0.11
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.09
63 0.13
64 0.17
65 0.22
66 0.24
67 0.27
68 0.33
69 0.41
70 0.46
71 0.53
72 0.59
73 0.63
74 0.69
75 0.75
76 0.73
77 0.75
78 0.71
79 0.62
80 0.58
81 0.53
82 0.44
83 0.43
84 0.41
85 0.33
86 0.34
87 0.33
88 0.29
89 0.28
90 0.27
91 0.2
92 0.19
93 0.16
94 0.12
95 0.11