Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D8PT71

Protein Details
Accession A0A1D8PT71    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40DQDSKSSQQHHNHNHHKKSGSHydrophilic
76-95PPSSRDSHGKHRNERRKSDSBasic
176-199RLDKLSVSKQKKPNHRPHNTGSVKHydrophilic
NLS Segment(s)
PositionSequence
84-112GKHRNERRKSDSQHSHHKKRENVSPRKTK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0009267  P:cellular response to starvation  
GO:0030447  P:filamentous growth  
GO:0036180  P:filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0036170  P:filamentous growth of a population of unicellular organisms in response to starvation  
KEGG cal:CAALFM_CR06300CA  -  
Amino Acid Sequences MTGLASRWATDETLVKQAIDQDSKSSQQHHNHNHHKKSGSDLEDSKWSKPITSKKSEALVSMWADAEDTSNSYPSPPSSRDSHGKHRNERRKSDSQHSHHKKRENVSPRKTKHNHDSTPRVRRDSPTHEDDEDNERGPMTPAAKAFAARFDKPTDKTAGNKHDHNRSTDGNSLAERLDKLSVSKQKKPNHRPHNTGSVKSETPRQDKSVVASEEDKQKEEKEKEELLKMLEELESQHLDWASME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.23
4 0.27
5 0.31
6 0.3
7 0.27
8 0.26
9 0.29
10 0.33
11 0.35
12 0.35
13 0.37
14 0.42
15 0.52
16 0.58
17 0.65
18 0.72
19 0.8
20 0.81
21 0.8
22 0.76
23 0.67
24 0.65
25 0.62
26 0.55
27 0.51
28 0.46
29 0.42
30 0.47
31 0.48
32 0.41
33 0.38
34 0.34
35 0.3
36 0.35
37 0.42
38 0.42
39 0.48
40 0.5
41 0.49
42 0.54
43 0.53
44 0.47
45 0.38
46 0.34
47 0.27
48 0.23
49 0.19
50 0.14
51 0.13
52 0.12
53 0.12
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.1
61 0.11
62 0.15
63 0.15
64 0.18
65 0.21
66 0.27
67 0.35
68 0.39
69 0.48
70 0.53
71 0.59
72 0.66
73 0.73
74 0.78
75 0.78
76 0.8
77 0.78
78 0.78
79 0.76
80 0.76
81 0.76
82 0.72
83 0.75
84 0.76
85 0.78
86 0.74
87 0.75
88 0.71
89 0.66
90 0.69
91 0.69
92 0.69
93 0.69
94 0.73
95 0.69
96 0.74
97 0.73
98 0.7
99 0.69
100 0.69
101 0.65
102 0.62
103 0.69
104 0.67
105 0.72
106 0.69
107 0.63
108 0.55
109 0.53
110 0.52
111 0.5
112 0.47
113 0.41
114 0.41
115 0.38
116 0.37
117 0.35
118 0.34
119 0.28
120 0.22
121 0.18
122 0.15
123 0.14
124 0.15
125 0.14
126 0.1
127 0.1
128 0.1
129 0.12
130 0.12
131 0.13
132 0.12
133 0.17
134 0.2
135 0.19
136 0.21
137 0.24
138 0.28
139 0.29
140 0.32
141 0.29
142 0.27
143 0.3
144 0.36
145 0.41
146 0.4
147 0.44
148 0.47
149 0.52
150 0.53
151 0.52
152 0.49
153 0.43
154 0.42
155 0.4
156 0.37
157 0.29
158 0.27
159 0.24
160 0.2
161 0.19
162 0.15
163 0.12
164 0.12
165 0.11
166 0.12
167 0.19
168 0.28
169 0.33
170 0.42
171 0.49
172 0.56
173 0.67
174 0.76
175 0.79
176 0.81
177 0.83
178 0.82
179 0.8
180 0.83
181 0.77
182 0.71
183 0.64
184 0.59
185 0.52
186 0.46
187 0.48
188 0.45
189 0.46
190 0.46
191 0.45
192 0.42
193 0.41
194 0.44
195 0.45
196 0.38
197 0.35
198 0.34
199 0.34
200 0.4
201 0.41
202 0.38
203 0.31
204 0.34
205 0.41
206 0.42
207 0.42
208 0.4
209 0.46
210 0.49
211 0.52
212 0.5
213 0.42
214 0.4
215 0.35
216 0.3
217 0.22
218 0.18
219 0.15
220 0.17
221 0.17
222 0.15
223 0.18
224 0.17