Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AM42

Protein Details
Accession S8AM42    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-81VMINSAKKKKAKKAAAAAKKTTHydrophilic
NLS Segment(s)
PositionSequence
65-80AKKKKAKKAAAAAKKT
Subcellular Location(s) plas 16, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLVASTVFLYYTVWTLLTPFIDEDHPIQSFFPPRVWAIRLPVILLLIISAVVGSFLSMVMINSAKKKKAKKAAAAAKKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.09
6 0.09
7 0.08
8 0.09
9 0.1
10 0.11
11 0.12
12 0.13
13 0.13
14 0.12
15 0.12
16 0.13
17 0.15
18 0.15
19 0.15
20 0.13
21 0.14
22 0.16
23 0.18
24 0.17
25 0.18
26 0.2
27 0.19
28 0.18
29 0.17
30 0.14
31 0.12
32 0.1
33 0.07
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.05
48 0.07
49 0.08
50 0.15
51 0.2
52 0.25
53 0.32
54 0.4
55 0.49
56 0.58
57 0.67
58 0.69
59 0.76
60 0.81
61 0.85